RetrogeneDB ID:
retro_mputfur_919
Organism:
Location:
GL896971.1:6526878-6527252 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.46 %
Coverage:
50.41 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
DCUN1D1
Parental gene aliases:
No gene alias available
Parental gene description:
DCN1, defective in cullin neddylation 1, domain containing 1 [Source:HGNC Symbol;Acc:18184]

Genomic region (view in browser)





>retro_mputfur_919
CTAAGGGCCCAGATACCCAAGATGGAAAAAGAATCGAAAGAACCAGGATGACTTAAGGAT
TTTTACCAGTTTACTTTTAATTTTGCAATGATTCTAAGATGGAAAGGATTAGATCTAAAA
ATGGCCATTGCCTACTTGAACTTAGTGCTTAAGGAAGATTTAAATTCTTAGACTTATGGA
ATAACTCTTTGGTGGAATATCATAAATGATCAATATAAAAAGATATTTGGAATCTTCCTT
TAACCATCAGTACAATGAATGCAGAGGACAATCTGTCAATTATGATGAAGAAAGAAAGAG
CATGGCATGTTCTTACTGACAATTTTGTGGAATTTGCCTGCCCTCAAATTGCTGGGACAA
GATGTACAACAGTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLN-GRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSN--YDEE
L.AQIPKME.E.KEPG..KDFYQFTFNFA.....KGLDL.MAIAY.NLVL..GRFKFLDLWN..L.E.HK.SI.KD.WNL.L..STM.A.D........E
Retrocopy
LRAQIPKMEKESKEPG*LKDFYQFTFNFAMILRWKGLDLKMAIAYLNLVLK/GRFKFLDLWNNSLVEYHK*SI*KDIWNLPLTISTMNAEDNLSIMMKKE


Parental protein
GAWPVLIDDFVEFARPQIAGTKSTTV
.AW.VL.D.FVEFA.PQIAGT..TTV
Retrocopy
RAWHVLTDNFVEFACPQIAGTRCTTV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide