RetrogeneDB ID:
retro_mputfur_92
Organism:
Location:
GL896981.1:8061209-8063807 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.9 %
Coverage:
85.8 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SMEK2
Parental gene aliases:
No gene alias available
Parental gene description:
SMEK homolog 2, suppressor of mek1 (Dictyostelium) [Source:HGNC Symbol;Acc:29267]

Genomic region (view in browser)





>retro_mputfur_92
ATGGAGAGAGGGAAACCTAAGATGGAAGTGAGAGGAAGTGGGACTCGAGGGAACTCTGCG
GACCTCAGGAACCACCAGCGTCCACCTGAACGCTACTTCTCTGCCATCTTCCACCGTAAT
TTTCCCCTCCCGCCACCTGAGCAATGGTCGCTGCCACAACAGCGACAACTACAGTCAACT
CCAGGCACATGCGACCCAGCGGCCCCCCACACCGAGACCAACACTGGGGACGGGAAGCCA
GCGGTCGCCATTGCCGACACACGGTATCTTGTAAAAGTCTACTCACTGAATGAGGACCAA
CAATGGGATGATCTCGGCACCGGGCACGTCTCCTCTACTTATGTGAAGCGCCTCCAGGGT
GTGTCCCTGCTCGTTAGGTCGGATTCCCAGGCCGCACTAATCTTGGAATCAAAGATAAAT
TCAAATACCCCCTATCAGAAACAACAGGAAACCCTGATTATTTGGTCTGAAGGAGAGAAC
CATGGTGTGGCATTAAGTTTCCAGGACACTGAGGGTTGCCATAAGATCTGGGAAGAAATT
TGCCACATTCAGGGAAAAGACCCATCCATCAAAATCACACAAGATCTCTTGGAGGAATCC
AAAGAAGAACAACTGCATGACGTCCTGGAAACCAATAATGTGTTTGACCTGCCTAACTGT
GAACTCTGTAAACTTGAAGAGATTGCTGACTTCATTACCGCCGTTCTCGCTTCACCGATC
CGTAAGGAGAGACTGGCTCTGATCTTAGAAAATGACGACTATATTAAAAATTTGCTGCAG
CTGTTCCACACTTGTGAGGACCTAGGGAACACTGCAGGCTTACATCATTTGCATACAATT
ATTAAAGGCATCTTATTCCTTAACAAGACAGCTCTGTTTGAGATCATGTTTTCTGCTGAG
TGTATCATGGATGTGGTGGGATGTCTTGAATATGACCCTGCTTTGGCTCAGCCAAAAAGG
CATAGGGAATTCTTGACCCAACATGCAAGGCTCAAGGAAGTTGTACCAATAACAAACGGT
GAACTTAGGCAAAAAATACATCAGACATATAAGATACAGTACATCTATGACATACTTTTG
CCAGCACCATCCATGTATGAAGAGAACTTTCTTTCGAGTCTTACAACTTTTATTTTCCTC
AACAAGGTTGAGATAGTCAGCATGTTGCAGGACGAAAACTTTTTGTCTGAAGTCTTTGCA
CAGTTAAAGAATGCGGCAATAGATGATGATAGACGGCGTGAATTGCTACTTTTCTTCAAG
GAATTCTGTGCATTTTCTCAGACATTACAGCCTCCAAAGAAGGATGCTCTGTTCAAAACA
CTGACAGAATTGGGAATTCTTCCTGTTCTTAAAATCGTAATGAGCATGGAGAATTTGCAA
ATAAGGTCAGCTGCTACTGATATATTTACTTATCTCGTAGAGTATAGTCCATCCATGATT
CGAGAATTTATCATGGAAGAAGCTCAGGAGAGTGAAGATGGTAACCTTTTCATTAACTTA
GTCATTGAGCAAATGATCTGCGATACTGATCCTGAGCTAGGAGGTGCTGTTCATTTAATG
GGACTTCTTCGTACTCTTCTTGATCCAGAAAACATGCATGCAACATCTACTAAATGTGAA
AGAAGTGAATTCCTAAATTTTTTCTACAAGCATTGTATACACAACTTCATAGCACCACTT
GTTGCCACCACTTCAGAAGATATATGTGAAGGGGATAGTGAAGTTGGGTCTGACGAAAAC
AACACACATTGCCTCAATAATTATCAAACAGCACAGCTGCTTTCTTTAATTTTAGAGCTG
CTCACATTTTGTGTGCAACATCACACATACTACATAAAAAATTATATTTTGAGCAAAGAC
TTGCTAAGAAGAGTCTTGATCTTGATAAATTCAAAGCACACTTTCCTGGTCTTGAGTTCG
CTCCGCTTTATGAGAAGGATGATTGGCCTTAAAGATGAACTTTATAATTGTTACATCATC
AAGGGAAATCTTTTTGAACCAGTTGTCAAAGCTCTTCTGGGTAATGGAACTCGGTACAAT
ATGTTGAATTCAGCTGCTATTGAGCTGTTTGAATACATAAGAGCGGAAAATATCAAATCT
CTTATTACACATATAGTTGAAAAGTTTTATAAGGCACTTGAATCGATTGAATATGTCCAG
ACATTCAAAGGATTGAAGATTAAATATGAACAAGAAAAAGACCGGCAGAATCAAATACGG
AAGAATTTACATTCTATCTTGCATAGTAAAATACTTCGCAGGAGTACCAGAGTCATGGAC
AAGAAGGAAGAAAAGTGTCTTAAAGGAAATTCAGAGGAAGGAGAAGCAACTATGCCACCA
CTGGAAGACAATTTTCAAGATCGTTTCAAATTTATGGAGACTAAAAAACCAAAGGAAAAT
GAAGACAAGGTAGCTCCTCCTAAAAGATCATCTTCAGGGGGCTACAAATACACCATATCC
CATTCTGCTGCTGCTGCTAATGGAACACGTAGCCTGCAGGGAAGCAGCACTGTTGGCTTA
ATGAATCCTCCCGATGATGATGAAAAAGATAAGGAAGATGAAACATCTCCCAGGAAGAGA
CCACATCTTAGCCTGTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQV
..DTR..VKVY.LNED.QWDD.GTGHVSSTYV..L.G.SLLVR..S...L.LESKIN.NT.YQKQQ.TLI.WSE.EN...ALSFQ...GC..IWE.IC..
Retrocopy
IADTRYLVKVYSLNEDQQWDDLGTGHVSSTYVKRLQGVSLLVRSDSQAALILESKINSNTPYQKQQETLIIWSEGENHGVALSFQDTEGCHKIWEEICHI


Parental protein
QGKDPSVEVTQDLIDESEEERFEEMPETSHLIDLPTCELSKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRG
QGKDPS...TQDL..ES.EE......ET....DLP.CEL.KLEEIAD..T.VL.SPIR.E.LAL.LEN..YIK.LLQLF..CE.L.NT.GLHHL..II.G
Retrocopy
QGKDPSIKITQDLLEESKEEQLHDVLETNNVFDLPNCELCKLEEIADFITAVLASPIRKERLALILENDDYIKNLLQLFHTCEDLGNTAGLHHLHTIIKG


Parental protein
ILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKV
ILFLNK..LFE.MFS.ECIMDVVGCLEYDPALAQPKRHREFLT..A..KEV.PIT..ELRQKIHQTY..QYI.DI.LP.PS..EENFLS.LT.FIF.NKV
Retrocopy
ILFLNKTALFEIMFSAECIMDVVGCLEYDPALAQPKRHREFLTQHARLKEVVPITNGELRQKIHQTYKIQYIYDILLPAPSMYEENFLSSLTTFIFLNKV


Parental protein
EIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVRE
EIVSMLQ.DE.FLSEVFAQL...A.DDD.RREL..FFKEFCAFSQTLQP...DA.FKTL..LGILP.L.IVM.M..LQ.RSAATDIF.YLVE.SPSM.RE
Retrocopy
EIVSMLQ-DENFLSEVFAQLKNAAIDDDRRRELLLFFKEFCAFSQTLQPPKKDALFKTLTELGILPVLKIVMSMENLQIRSAATDIFTYLVEYSPSMIRE


Parental protein
FVMQEAQQSDDDILLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDNIVGSNKNST
F.M.EAQ.S.D..L.IN.VIEQMICDTDPELGGAV.LMGLLRTL.DPENM.AT..K.E.SEFLNFFY.HC.H...APL...TSED.CE.D..VGS..N.T
Retrocopy
FIMEEAQESEDGNLFINLVIEQMICDTDPELGGAVHLMGLLRTLLDPENMHATSTKCERSEFLNFFYKHCIHNFIAPLVATTSEDICEGDSEVGSDENNT


Parental protein
ICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLL
.C..NYQTAQLL.LILELLTFCV.HHTY.IKNYI..KDLLRRVL.L.NSKHTFL.L..LRFMRR.IGLKDE.YN.YI.KGNLFEPV..ALL.NGTRYN.L
Retrocopy
HCLNNYQTAQLLSLILELLTFCVQHHTYYIKNYILSKDLLRRVLILINSKHTFLVLSSLRFMRRMIGLKDELYNCYIIKGNLFEPVVKALLGNGTRYNML


Parental protein
NSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPV
NSA.IELFE.IR.E.IKSL..HIVE.FYKALESIEYVQTFKGLK.KYEQEKDRQNQ......SIL.S...RR........EE........EEG.A...P.
Retrocopy
NSAAIELFEYIRAENIKSLITHIVEKFYKALESIEYVQTFKGLKIKYEQEKDRQNQIRKNLHSILHSKILRRSTRVMDKKEEKCL-KGNSEEGEATMPPL


Parental protein
E
E
Retrocopy
E


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide