RetrogeneDB ID:
retro_mputfur_922
Organism:
Location:
GL896973.1:4018782-4019113 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.37 %
Coverage:
94.07 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
ATP6V1G1
Parental gene aliases:
No gene alias available
Parental gene description:
ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864]

Genomic region (view in browser)





>retro_mputfur_922
ATTCAACTTAATAGGAAATGTAGGAAGTGGGTCTCTGAGCAGGTGTCAGAAGCCCACAAG
CAAAAGAAACAAAGGGTGAAGCAGGCCAAAGAAGCAGCTCAGGCTGAAATTGAACAATAC
ACCTGCAAAGAGAGAAGGAGTTCAAGGCCTTGGAAGATGCAGTCTGGGATCCCTGTGCAG
CTGCAGCACAGAAGTGGAGAACAAGACCCAGGAGGAGATGGCCATCCTCCGGACCTTCTT
CCAGCAGAACAGGGATGAAGTCCTGCATCACCTCTTGGCCTTTGTCATTGACACCTGGCC
AGAAATGCATGAAAATCACTGCATCAATGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQY-RLQREKEFKAKEAA-ALGSHGSCSTEVEKETQEKMTILQTYFQQNRDEVLDNLLAFVCD
IQ......K...E.VSEA.K.K..R.KQAKE.AQAEIEQY..LQREKEFKA.E.A..LGS..SCSTEVE..TQE.M.IL.T.FQQNRDEVL..LLAFV.D
Retrocopy
IQLNRKCRKWVSEQVSEAHKQKKQRVKQAKEAAQAEIEQY/HLQREKEFKALEDA/SLGSLCSCSTEVENKTQEEMAILRTFFQQNRDEVLHHLLAFVID


Parental protein
IRPEIHENYRING
..PE.HEN..ING
Retrocopy
TWPEMHENHCING


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide