RetrogeneDB ID:
retro_mputfur_923
Organism:
Location:
GL896974.1:1430326-1430695 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
61.79 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
5


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_923
CTAGAGACATTCAGAATGATCCAGAATCTGACATACCATCATAGGCTGTCCTATAATACA
GCCTTTAACAAAACTAAGCTGTTCTGAACCCTTGGTAATAGAATTGTGCACCTTTATACC
AACAATGTTGGGAAAGCACCAAAATCCACATGGGGCATGTGACCAGGCTGATTTCAAGAA
GTTTGTGTTGTAAAACCTGAAGTTCATATGAGGTGGTCTGAAACAAACAAATAACATGTC
AGCAGGGCCTGTAGTGGTTCCCTATATGATAAGTGTGTCTATGACCAGATCAAGTGTGCT
TTCCTTACCAAGGAGCATAATAACACTGTGAAAGTGTTGAAGGCACAAGCATAAAGTCAG
AAAGCTAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKAFRMVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKK-HVSRAYGGSMCAKCVRDRIKRA
...FRM.Q.LTY..RLSYNTA.NKT.L..T.GNRIV.LYT..VGKAPKS..G..PG....V..V.P.V.MR.S.T.K.HVSRA..GS...KCV.D.IK.A
Retrocopy
LETFRMIQNLTYHHRLSYNTAFNKTKLF*TLGNRIVHLYTNNVGKAPKSTWGM*PG*FQEVCVVKPEVHMRWSETNK*HVSRACSGSLYDKCVYDQIKCA


Parental protein
FLIEEQKIVVKVLKAQAQSQKAK
FL..E....VKVLKAQA.SQKAK
Retrocopy
FLTKEHNNTVKVLKAQA*SQKAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide