RetrogeneDB ID:
retro_mputfur_924
Organism:
Location:
GL896974.1:1747102-1747541 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.24 %
Coverage:
90.18 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
BTF3L4
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3-like 4 [Source:HGNC Symbol;Acc:30547]

Genomic region (view in browser)





>retro_mputfur_924
AGATTTACCAACAGCACGAATCAAGAAAAGCTAGCTAAACTTCAGGCTCAGGTCCGGATA
GGGGGCAAGGGTACAGCCTGCAGAAAGAAGGTGGTACATAGAAGAGCTACAGCTGATGAC
AAAAAACTCCAGAGTTCTCTAAAAAAACTGGCTGTGAATAATATAGCTGGTATTGAAGAG
GCGAACATGATTAAAGATGATGGGACAGTTATTCGTTTCAACAGTCCCAAAGTCCAAGCT
TCCCTTTCTGCTAACACCTTTGCAATTACTGGGCATGCAGAAGCCAAACCAATCACAGAA
ATGCTTCCTGGAATACTAAGTCAGCTTGGTGCTGACAGCTTAACAAGTCTTAGGAAGTTA
GCTGAACAGTTCCCATGGCCAAGTGTTGGATAGCAAAGCAACAAAACCAGAAGACATTGA
TGAAGAGGATGATGATGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RFTNSMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPIT
RFTNS.NQEKLAKLQAQVRIGGKGTA.RKK.VVHR.ATADDKKLQSSLKKLAVNNIAGIEE.NMIKDDGTVI.FN.PKVQASLSANTFAITGHAEAKPIT
Retrocopy
RFTNSTNQEKLAKLQAQVRIGGKGTACRKK-VVHRRATADDKKLQSSLKKLAVNNIAGIEEANMIKDDGTVIRFNSPKVQASLSANTFAITGHAEAKPIT


Parental protein
EMLPGILSQLGADSLTSLRKLAEQFP-RQVLDSKAPKPEDIDEEDDDV
EMLPGILSQLGADSLTSLRKLAEQFP..QVLDSKA.KPEDIDEEDDDV
Retrocopy
EMLPGILSQLGADSLTSLRKLAEQFP\GQVLDSKATKPEDIDEEDDDV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide