RetrogeneDB ID:
retro_mputfur_929
Organism:
Location:
GL896975.1:8001537-8002136 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.31 %
Coverage:
97.6 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7 [Source:HGNC Symbol;Acc:10363]

Genomic region (view in browser)





>retro_mputfur_929
TTAAAGTGAGTCCATAAGAAGCCTATCTATGAAAAAGCTAAGCATTGCCGTAAGGAGTAT
AGGCCGGTGGGAGGAACTGAGATTCGAATGGCTAGCAGAGGAGCTGGCAGCTTCTTGGTA
TCGGCGGAGCCCAAATCAGCATGTATCAGCAGGATCAGAGGTATCAGTGCTGTGAGCCCC
AGGGTTCAACAGGTGCAGGAGTTCTACGCCTTCACTAGATCTTCAATGGCAACTTTGTTA
AGCTCAGCAGGGCTACAGTTAACAGGCTAAGGACTGTGGAACCATATAGAGCATGGGGGG
ACCCAACCCTGCAGTTGATGAATGAATTGATCTACAAACGTGATTATGGCAAAATCAACA
AGAAGCAGATTGCCCTGACAGATAACACATTGATCATTCCATCTCTTAGTAACCGGGGCA
TCATCTGCATAGAGGATCTGATTCCTGAAATCTATACCATTGGAAGACATTTCAAAAGAA
GCAACTTTTTACAGACCTTCAATTATCTTCTCCACAGTGGGGGAATGAAGTAGAAGACCA
CCCGCTTTGCAGAAGGTGGAGATGCTGGCAACGGGGAAGAGCGGATCAATAGGTTATTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQ-LLRLRQIFNGTFVKLNKASVNMLRIVEPYI
L.....K.IYEKAKH..KEYR....TEIRMA...R.AG.F.V.AEP.............VSP.V..V....LRL..IFNG.FVKL..A.VN.LR.VEPY.
Retrocopy
LK*VHKKPIYEKAKHCRKEYRPVGGTEIRMA--SRGAGSFLVSAEPXXXXXXXXXXXXAVSPRVQQVQE/VLRLH*IFNGNFVKLSRATVNRLRTVEPYR


Parental protein
AWGYPNLKSVNELIYKRGYGKINKKRIALTDNTLIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQI
AWG.P.L...NELIYKR.YGKINKK.IALTDNTLI..SL...GIIC.EDLI.EIYT.G..FK...NFL..F......GGMK.KTT.F.EGGDAGN.E..I
Retrocopy
AWGDPTLQLMNELIYKRDYGKINKKQIALTDNTLIIPSLSNRGIICIEDLIPEIYTIGRHFKR-SNFLQTFNYLLHSGGMK*KTTRFAEGGDAGNGEERI


Parental protein
NRLI
NRL.
Retrocopy
NRLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide