RetrogeneDB ID:
retro_mputfur_930
Organism:
Location:
GL896975.1:4454875-4455270 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.31 %
Coverage:
53.54 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
Cnpy2
Parental gene aliases:
No gene alias available
Parental gene description:
canopy 2 homolog (zebrafish) [Source:MGI Symbol;Acc:MGI:1928477]

Genomic region (view in browser)





>retro_mputfur_930
CCCAAGAAGACCTTTCAGATGGGCTCTTTCCAAATCAACCCAGATGATCACCATTCAGGG
GTGGAGGTGCCCCATGCTCATGCAGAGGCCTGTCTCACAGAGCTGCTGACTGGATGCAGG
AGCACGGCGGTCAGACTGACCCCTCCACCCACTGCAAGAACTATGTCCATGGAGTGCACC
AAAATGGAGAATCCAATGAACTGGACCTGGAGGCTATCTGGACAGATTCAGACATGTGGG
GCACTCTCAAATTTGCCAGTGAGAGTACTGTGGAGGAACAGGAGGGTGAACTCATTGAAT
TCTATTCCCAAGAGGCTGACGATGCGAAAGACAAACTTACTTGTAGCTGAACAGAAGTAT
GGGCTCATGCCCTGGACATATCCCTCGATGAGCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEV-CDRMKEYGEQIDPSTHRKNYVRVVGRNGESNELDLQGIRIDSDISGTLKFACESIVEEYE
PKKT.QMGSF.INPD...S.VEVP.....AH....L.E...D.M.E.G.Q.DPSTH.KNYV..V..NGESNELDL..I..DSD..GTLKFA.ES.VEE.E
Retrocopy
PKKTFQMGSFQINPDDHHSGVEVPH----AHAEACLTEL/ADWMQEHGGQTDPSTHCKNYVHGVHQNGESNELDLEAIWTDSDMWGTLKFASESTVEEQE


Parental protein
DELIEFFSREADNVKDKLCSKRTDLCDHALHISHDEL
.ELIEF.S.EAD..KDKL....T....HAL.IS.DEL
Retrocopy
GELIEFYSQEADDAKDKLTCS*TEVWAHALDISLDEL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide