RetrogeneDB ID:
retro_mputfur_931
Organism:
Location:
GL896976.1:5935121-5935624 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.67 %
Coverage:
62.83 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_931
GGGAGGGGTGGGGAAGGTGGGCTTGGAATGGGAGGTAGGGCTGGCTTCCCCTGAGGCTTC
AGCAGCAGCATCGGGACCATGGGGGCGGTGAGTCTGGCTGGGGCTGAGGCCAGGGAGCTC
AAGGAGGTAAGGCCACGACAAGGAGCAGATCTCTGTCACCAAGCTGGGCCGCCTGGTCAA
GGACATGAAGATCAAATCCCTGGAGGACATCTGTCTCTTCTCCCTGCCCATCAAAGAATG
TGAGATCATTGACTTCTTCCTGGGAGCATCCCTCAAGGATGAGGTTTTGAAGACCATGCC
TGTGCCAAAAGCAGACCCATGTAGCCCAGTGGACCAGGTTCAAGGCATTTGTTACTATCG
GAGGTTACAGTGGACACCTATGTCTGGGGGTCAAGTGCTCCAAGGAGGTAGCCACTGCCA
TCCGTGGGGACATCACCCTGGCCAAGCTCTCCATCGTCCCACTGTGGCAAGGCTACTGGG
GAAAAGATCAGCAAGTCCCACAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GPGGPGGPGMGGRGGFRGGFGSGI-RGRGRGRGRGRGRGRGARGGKA-EDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVL
G.GG.GG.GMGGR.GF..GF.S.I.R..G.G...G.G.G.GA.GGKA..DKE.I.VTKLGRLVKDMKIKSLE.I.LFSLPIKE.EIIDFFLGASLKDEVL
Retrocopy
GRGGEGGLGMGGRAGFP*GFSSSI/RDHGGGES-GWG*GQGAQGGKA/HDKEQISVTKLGRLVKDMKIKSLEDICLFSLPIKECEIIDFFLGASLKDEVL


Parental protein
KIMPV-QKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPH
K.MPV.QKQT...Q.TRFKAFV.IG.Y.GH..LGVKCSKEVATAIRG.I.LAKLSIVP...GYWG.....PH
Retrocopy
KTMPV\QKQTHVAQWTRFKAFVTIGGYSGHLCLGVKCSKEVATAIRGDITLAKLSIVPLWQGYWGKDQQVPH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide