RetrogeneDB ID:
retro_mputfur_932
Organism:
Location:
GL896976.1:6501120-6501737 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.34 %
Coverage:
75.99 %
Frameshifts:
6
Stop codons:
5


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_932
GTGTCTGGAGCTCTTGCTGACCTACAGAAAAAGGAGATGTCCTCAATTCCTTGTGGAAGT
ACAACTTGGATGGCACTGACCTTGGTTTTCAAATGGAGCGGTACATCTACAGAAGAAAAT
GAGAGGATTGCATCACGAATCTGAAGAGAACAAGATAGAAGCTTCTGCTTGGCAGTTCCA
GCCACTGTTTCTATTGAAAACCCAGCTGATGTCATGTCACATCCTCTAGGAATCCTGGCC
GGCGAGCTGGGCAGAAGGGTGCTGTTGCCACAGGGGCCACTCCTGTTCCTGGCTGCTTCC
CTCCTGGAACCCTCCCCAGCTAGATCTGGGTCGCTGTCTGGGAGTCATTCCTTCTGGAAG
ATACTGATCCCAAGGCTGACCACGAGCCTCTCAGAGAACTGTCTTCAGGGAACCTGTCTC
CATTGTTCTTTGAAACACAGACCCTCCTCTGTGCCGTATGGACGCCGCCATCCCAGCACC
AACAAGGAGCTCCCTGAGCAGGTCTGATGCAGATGCTGGCCCTGGAGGTTCTGCGCGCAC
ACGGTAACATCTCCTGTGAACTCCCATGGCAGATCACGCCTCGTCTCTACTCCAGAGATC
CTGAAGAGATCGAGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSGALDVLQMKEE-DVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLL-AARAIVAIENPADVS-VISSRNTGQRAVLKFAAATGAT
.SGAL..LQ.K.E.DVL..L.....L.GT.L.FQME.YIY.RK.....I.NLKRT..KLLL.A..A.V.IENPADV..V.SSRN.G.RA..K.A.ATGAT
Retrocopy
VSGALADLQ-KKE/DVLNSLWK-YNLDGTDLGFQMERYIYRRK*EDC-ITNLKRTR*KLLL\AVPATVSIENPADVM/VTSSRNPGRRAGQKGAVATGAT


Parental protein
PIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLP-TIALCNTDSPLRYVDIAIPC-NNK-GAHSVGLMWWMLAREVLRMRGTISREHP
P..G.F.PGT....I..A..E..LL..TDP.ADH.PL.E.S..NL...I.L.NTD.PL...D.AIP...NK.GA...GLM..MLA.EVLR..G.IS.E.P
Retrocopy
PVPGCFPPGTLPS*IWVAVWESFLLEDTDPKADHEPLRELSSGNLS/SIVL*NTDPPLCRMDAAIPA/TNK/GAP*AGLM-QMLALEVLRAHGNISCELP


Parental protein
WEVMPDLYFYRDPEEIEK
W...P.LY..RDPEEIEK
Retrocopy
WQITPRLY-SRDPEEIEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide