RetrogeneDB ID:
retro_mputfur_937
Organism:
Location:
GL896976.1:8020373-8021205 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.46 %
Coverage:
61.28 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
NONO
Parental gene aliases:
No gene alias available
Parental gene description:
non-POU domain containing, octamer-binding [Source:HGNC Symbol;Acc:7871]

Genomic region (view in browser)





>retro_mputfur_937
GTCATCGTGGGTGATTAAGAAAGGCACTCAAGAAAAGACATTGTTGAACTCGCAGGGAAG
CCACAGTTCAGAAGGTTCTGGACAGGTGCAGTGAAGGAGCCTTCCTGCTAATCACATTTC
CCTGGGCCGTGACTGTGGAGCCCATGGACTGGTTGGATGATGAAGAGGACTTCCAGAGAA
GCTGGTGATAAAGAACCAGCAATTTCACAAGGAGCGAGAGCAGCCGCCCAGATTTGCACA
GCCTGGCTCCTTGGATTACGAGTATACCAGGAGCTGGAGGACACTCACTGAGATGGAAAA
GCAGCAGGACCAAGCAGACCACAACATCAGGGAAGCTGGTGAGAAGCTGGAGGTGGAGAT
GGAGGCCACTCACCATGAGCACCAGGTCATGTTAATGAGACAGGATTTGACGAGGCAACG
AGAACAACTTTGGAGGATGGAAATGTTGCTCAACCAAGAAGTGCAGAAAGGAAAACAACT
GGAGCTCAGACAGGATTTGGAGCGTAGGTGCATGAGGAAGAGCTGTGGCAATGGTAAGAA
GGATTCAAGGGAACATGCGCTGAGGCAAGAGAACAGAAGACACGGTGGACCAGATGGCTA
AGGGAGGTGCTATGGGCATCAGCAACAGAGGCACCGTGCCCCTGCTCCAGTGCCAGCTGG
TACCCCAGCTCCTCCAGGACCTGCCACTATGATGCCACATGGAACCTTGGAATCGACTCC
ACCAACCACTGAACCCTTTGGCCAAGTTGCTACAGTGGAAGGAATTGGGGCAATTGGTGG
AACCCCTCTTGTGTTCAACCATGCAGCTCCTGGAGCTGAATTTACTCCAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VIVDDRGRPSGKGIVEFSGKPAAR-KALDRCSEGSFLLTTFPRPVTVEPMDQLDDEE-GLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIE
VIV.D..R.S.K.IVE..GKP..R.K.LDRCSEG.FLL.TFP..VTVEPMD.LDDEE.GLPEKLVIKNQQFHKEREQPPRFAQPGS..YEY...W..L.E
Retrocopy
VIVGD*ERHSRKDIVELAGKPQFR/KVLDRCSEGAFLLITFPWAVTVEPMDWLDDEE/GLPEKLVIKNQQFHKEREQPPRFAQPGSLDYEYTRSWRTLTE


Parental protein
MEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRR-QQEEMMRRQQEGFKGTFP
MEKQQ.DQ.D.NI.EA.EKL..E.E.....H......Q....RQ...R..E.L...E.......E.........R....RR...EE......EGFKGT..
Retrocopy
MEKQQ-DQADHNIREAGEKL--EVEMEATHHE----HQVMLMRQDLTRQREQLWRMEMLLNQ--EVQKGKQLELRQDLERR/VHEEELWQW*EGFKGTCA


Parental protein
DAREQEIR-MGQMAMGGAMGINNRGAMP-PAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPN
.AREQ..R...QMA.GGAMGI.NRG..P.PAPVPAGTPAPPGPATMMP.GTL..TPPTTE.FGQ.AT.EGIGAIGGTP..FN.AAPGAEF.PN
Retrocopy
EAREQKTR/VDQMAKGGAMGISNRGTVP/PAPVPAGTPAPPGPATMMPHGTLESTPPTTEPFGQVATVEGIGAIGGTPLVFNHAAPGAEFTPN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide