RetrogeneDB ID:
retro_mputfur_939
Organism:
Location:
GL896977.1:4832546-4832866 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.37 %
Coverage:
91.38 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
NDUFA5
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 [Source:HGNC Symbol;Acc:7688]

Genomic region (view in browser)





>retro_mputfur_939
CTGATGGGGTTGGTTATATGTGAAAGTCCACATGAAAGGCTAACAATGTTGTACACAAAG
ATTCTTGATGTTCTTGAGCAGATTTCTGAAAATGCAGCCTATAGCACATATTCAGAACAG
ATTGCAAATGAGAAGCTGGGTCCACTGGTTAAAGTGGAACCAGATGTTAAGAAATTAGAA
GACTAACTTCAGAGTGGCCAACTAGCAGAGGTGATGCTTGAGGCTGAAAATGAAGTAAGT
CTGGCAGGAAAAATGATACACTGGAAACCATGGGAGCCTTTAGCAGAAGAGCTTCTTGCC
ACCAGTGGAAATGACCAATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LVGLAVCESPHERLRILYTKILDVLEQIPKNAAYRKYTEQITNEKLS-MVKAEPDVKKLEDQLQCGQLEEVILQAENELSLARKMLQWKPWEPLVEE-PP
L.GL..CESPHERL..LYTKILDVLEQI..NAAY..Y.EQI.NEKL...VK.EPDVKKLED.LQ.GQL.EV.L.AENE.SLA.KM..WKPWEPL.EE...
Retrocopy
LMGLVICESPHERLTMLYTKILDVLEQISENAAYSTYSEQIANEKLGPLVKVEPDVKKLED*LQSGQLAEVMLEAENEVSLAGKMIHWKPWEPLAEE/AS


Parental protein
ANQWKWPI
..QWK.P.
Retrocopy
CHQWK*PM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide