RetrogeneDB ID:
retro_mputfur_944
Organism:
Location:
GL896977.1:5946619-5947316 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.68 %
Coverage:
53.09 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
EEF1G
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation elongation factor 1 gamma [Source:HGNC Symbol;Acc:3213]

Genomic region (view in browser)





>retro_mputfur_944
ATGGCAGCTGGCACCGTGTTCATGTACCCTGAAACCTGGAGGACCGTCAAGGCTCTCATT
GCTGCTCAGTCCAGAGGGGCTCAGGTCTGTGTGCTCTCTACACTACCCGACTTCCACTTT
AGCCAAACCAAACGCAGCCCTGAATTTCTCTGTAAATGTCCTGCTGGCAAGCTTCCAGCA
TTTGAGGGCGATGATGGATTCTGTGTGTTTGACAGTGATGCCATTGCTTAGTATGTGAGC
AATGAGGAGCTGTGGGGAAGTTCTCCAGAGACAACAGCCCAGGAGGTACAGTGTGTGAGC
TTGGCTGATAGCGATATAGTGCTGCCCACCAGCAGCCGGGTGGGCCCCACCTCAGGCATC
ATGCACCACAACAAGCAGGCCCCAGAGAATGCAAAGGAGGAAGCGAAGCAACTTCTGGGG
TTACTGGATGCTCCCTTGAAGACAAGGACTCTCCTGGTGGTCACCTGTGTTGACATTGGC
TGACATCACGATTGTCTGCACCCTGCTGTGGCTCTAGAAACAGGTCCTGGAGCCTTCTCT
CTGCCAGGCCTTCCCCAATACCAACTGCTGCTTCCTCACCTGCGTTGACCAACCCCAGTT
CAGGGCTGTCTTGGGGGAGGTGAAACTCTGTGAAAAGATGGCCCAGTCTGTTGCTAAAAA
GTTTGCAGAGAGCCAGCCTGAAAAGGACATATCCCGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVS
MAAGT...YPE.WR..KALIAAQ..GAQV.VLS..P.FHF.QT.R.PEFL.K.PAGK.PAFEGDDGFCVF.S.AIA.YVSNEEL.GS.PE..AQ.VQ.VS
Retrocopy
MAAGTVFMYPETWRTVKALIAAQSRGAQVCVLSTLPDFHFSQTKRSPEFLCKCPAGKLPAFEGDDGFCVFDSDAIA*YVSNEELWGSSPETTAQEVQCVS


Parental protein
FADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAHLKTRTFLV-GERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQ
.ADSDIV.P.S..V.PT.GIMHHNKQA.ENAKEE....LGLLDA.LKTRT.LV.....TLADIT.VCTLLWL.KQVLEPS..QAFPNTN..FLTC..QPQ
Retrocopy
LADSDIVLPTSSRVGPTSGIMHHNKQAPENAKEEAKQLLGLLDAPLKTRTLLV\SPVLTLADITIVCTLLWL*KQVLEPSLCQAFPNTNCCFLTCVDQPQ


Parental protein
FRAVLGEVKLCEKMAQFDAKKFAESQPKKDTPR
FRAVLGEVKLCEKMAQ..AKKFAESQP.KD..R
Retrocopy
FRAVLGEVKLCEKMAQSVAKKFAESQPEKDISR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide