RetrogeneDB ID:
retro_mputfur_953
Organism:
Location:
GL896981.1:622000-622499 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.76 %
Coverage:
59.5 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_953
ATGTCCGGACCCCGTGACATCCCAAAAATTAAGAAGGAGAATGTCCTTAAATTCCTTGCA
GCAGGAACCCACTTAGGTGTCACCAAGCTTGACATCCAAATGAAACAGACCATGTACAAA
AGGAAAAGTGATGGCATCTACTTCACAGATCTGAAGAGAATCAGGGAGAACCTTCTTTCG
GCAGTTTCTTCCGCTGTTGCCACTGAAAATCCAGCTGATGCTCGGTATCATATCCTTCAA
GAATACTGGCCAGTGGGCTGTGCTTTAAGTTGCAGTTGCCGGTGGGGCCACTTCTACTGT
TGGCCACATTACTCCCGAAAACTTCACTAATCAGGTCCAGGCCTCTTTCTGGGAGCTGCA
ACTTCCAGAAGTTACTATATCCCAGAGCTGAGCACAAGCTTCTTACCGTGGCGTCTTAAG
TTAACTTGCCAACCATTAGTCTGTTAACACAGATTCTTCTCTGTGCTATGTGGATGTGGT
GTCCTCACACAACAATAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPAD-VSVISSRNTGQRAVLKFAAATGATPI
MSG..D....K.E.VLKFLAAGTHLG.T.LD.QM.Q..YKRKSDGIY...LKR..E.LL.A....VA.ENPAD....IS..NTGQ.AVL..A.A.GAT..
Retrocopy
MSGPRDIPKIKKENVLKFLAAGTHLGVTKLDIQMKQTMYKRKSDGIYFTDLKRIRENLLSAVSSAVATENPAD\LGIISFKNTGQWAVL*VAVAGGATST


Parental protein
AGRFTPGTFTNQIQAAFREPRLLVVT-DPRADHQPLTEASYVNLPTIAL-CNTDSPLRYVDIAIPCNNK
.G..TP..FTNQ.QA.F.E..L..VT..PRA.H..LT.AS.VNLPTI.L..NTDS.L.YVD.....NNK
Retrocopy
VGHITPENFTNQVQASFWELQLPEVT\YPRAEHKLLTVAS*VNLPTISL/VNTDSSLCYVDVVSSHNNK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide