RetrogeneDB ID:
retro_mputfur_954
Organism:
Location:
GL896981.1:4396235-4396592 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.29 %
Coverage:
54.38 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
BCL7C
Parental gene aliases:
No gene alias available
Parental gene description:
B-cell CLL/lymphoma 7C [Source:HGNC Symbol;Acc:1006]

Genomic region (view in browser)





>retro_mputfur_954
AGTTTCCATTCGGAAGGCTCCCTGCAAAATGGCACTGATCCCAGCCCTGGGGGCATTTGC
CAGCCCAGCTGCCCTTTGTCACCTCCCAGACTACCAGAAGGGGTTCCAGAGGGTGCTCGG
CCCCCACGGCTGGTCTAAAGAGAGCCATCCCGGGAGCATTACTGCAGGCAGCATTGACGA
ACCCCAGTGCTGACCAAGGAGGATTCTGTTTCAGAACTGCTGGAGGCTGAGGCCTTTGGA
GTTAACCCTACCTTTGAGCTAGTGCTGCCTGTCCCCAAGGCAGCCCAGGGCAACACAGAG
CACTCAGGGTACCCTCTCCCCCTATTCAAGCACTACTGCCCAAATGCCCCGACCCCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEDAQPPRL-GQERDPGAETAGSTDEP-PMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGD
SFHSEGSLQ.GT.PSPGG..QPS.P.SP...PEGVPE.A.PPRL...E..PG..TAGS.DEP.P.LTKE..V.ELLEAEA....P.FE.V.PVP.AAQG.
Retrocopy
SFHSEGSLQNGTDPSPGGICQPSCPLSPPRLPEGVPEGARPPRL\SKESHPGSITAGSIDEP/PVLTKEDSVSELLEAEAFGVNPTFELVLPVPKAAQGN


Parental protein
TEDSEGAPPL-KRICPNAPDP
TE.S....PL.K..CPNAP.P
Retrocopy
TEHSGYPLPLFKHYCPNAPTP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide