RetrogeneDB ID:
retro_mputfur_955
Organism:
Location:
GL896981.1:7133623-7133928 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.35 %
Coverage:
56.59 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
SAP30L
Parental gene aliases:
No gene alias available
Parental gene description:
SAP30-like [Source:HGNC Symbol;Acc:25663]

Genomic region (view in browser)





>retro_mputfur_955
ATCCAGAGTGTATTAAATAAGAGGAAGAGGAAGACAAGTAACAATGACAGAAATTCTGAG
CAGGATACCGACGTTTCTGAGGTTGACCTGTTTCAGCTGCAGGTGAACACTCTGTGATGT
CCTAAATGACACTATTAATTCCAGAACAGCCTGGGCTTCTGTGAGCCCCAGTTAGCAGAA
ACTGTCAGCTGACACTTCAGAAACATAACTGCGAATGCGAAGAGACTCTTGCCTACTTAA
TCTCCATGGTAAAGAGTAACACAAGTAGAATGGACCAGAAATTGAAGGGCAGCAAGGAGC
TTCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEK-ETLAYFIYMVKSNKSRLDQKSEGS
IQSV.NKRKRKTS.....S.E.DTD..EVDLFQLQVNTL...K.HY..Q...GF...QLAETVS.HFRNI..N.K.ETLAY.I.MVKSN.SR.DQK..GS
Retrocopy
IQSVLNKRKRKTSNNDRNS-EQDTDVSEVDLFQLQVNTL*CPK*HY*FQNSLGFCEPQLAETVS*HFRNITANAK/ETLAYLISMVKSNTSRMDQKLKGS


Parental protein
KQLE
K.L.
Retrocopy
KELQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide