RetrogeneDB ID:
retro_mputfur_956
Organism:
Location:
GL896981.1:599002-600180 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.85 %
Coverage:
100.0 %
Frameshifts:
6
Stop codons:
7


Parental gene:
Parental gene symbol:
RBMX
Parental gene aliases:
No gene alias available
Parental gene description:
RNA binding motif protein, X-linked [Source:HGNC Symbol;Acc:9910]

Genomic region (view in browser)





>retro_mputfur_956
AAATTAGTTGAACCAGATCACCCAGGAAAGCTCTGCATTGGTGGCCTGAAACAGAAACAA
ATAAGGAAGCCCTTGAAGTCATATTTGGCAAATATGGACAAATAATAGAAGTTCTATTGA
TGAAAGATCATGAAACTAACAAATCAAGAGCATTTGCTTTTGTCATGTTTGAAAGCCCAG
CTGAAGCTAAAGGATACAGCCAAAGATGTGAACAGAAAGTCCTTAGATGGAAAAGCCATT
AAGGTAGAACAAGCCACTGAGCCATCATTTGGAAGTGGTAGATATGGACCACCTTCACCT
CTAAGAAGCAGAAGCCCTCCAAAAGGTCTTAGAGCTGGAAGAAGATGAAGTGGAGGAACC
AAGGGGACCTCCCTCATGCAAAAGGCCTATGGATCATGGTGGCTATTCTGTGATTTTTAA
TATAAATTCTTCCAAGGGACCACTTCCAATAAAAAGGGGACCACTACCCCAAAGTGGCTG
TCCTCCTCCTAAAAGATATGCCCCTTCAGGACAAGTTCATATCAACAATGGAATGGAAGG
TAAAGCTCCTGTACAACATGGAAGAGATAGTTAGGGAGGCAAAACTTGAAAGAAACCCCT
GCCCTCTCATAGGGATGTTTATTTGTCCCCAAAAGATGATGGGTATTCTACTAAAGATAG
TTATTCAATGAGAGATTTCCCAAGTTCTTGTGATACCAGAGATTAAGTACTACCACCAAG
AAGATTATACTTACTGTGATTATGGTCATTCCAGTTCACATGATGATTACCCATCAAGAG
GCTGTAGTATTAGAGATGACTATGGTCCTGATCTTAACTATTTAGATCATACAAGTGGAA
GTTCCTATGGAGATTGATATGAGAGTTATGGTAACTCACTTAGTGCTCTAACTACATGAG
GACCCCTGCCATCTTGTAGGGGAAACAGTCACTGTGATGATTACAGCAGCTCATATGATG
GGTATGGTGGAAGTCAAGACAGTTACTCAGGCAGTGGAAGTGATCTCTACTCACGTGGTC
ATGATCTGGCTGGCAGACAAGAAAGAGGCCTTCCCCCTTCTGTGGAAAAGAAGGTATCCT
CCTCCATGTGATTCCTACACCACTTCAATTCACAGAGCACCCAGAGGTGGAAGCTATGGA
GGAAGCTGATCTGACAGAGGTGAGGCAGAAGCAGATAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KMVEADRPGKLFIGGLN-TETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAK-DAARDMNGKSLDGKAIKVEQATKPSFESGRRGPP
K.VE.D.PGKL.IGGL..TETN..ALE..FGKYG.I.EVLLMKD.ETNKSR.FAFV.FESPA.AK.D.A.D.N.KSLDGKAIKVEQAT.PSF.SGR.GPP
Retrocopy
KLVEPDHPGKLCIGGLK/TETNKEALEVIFGKYGQIIEVLLMKDHETNKSRAFAFVMFESPAEAK\DTAKDVNRKSLDGKAIKVEQATEPSFGSGRYGPP


Parental protein
PPPRSRGPPRGLRGGRGGSGGT-RGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRR
.P.RSR.PP.GLR.GR..SGGT.RGPPS....MD.GGYS..FN..SS.GPLP.KRGP.P.SG.PPPKR.APSG.V....GM.G.APV..GRDS.GG....
Retrocopy
SPLRSRSPPKGLRAGRR*SGGT\RGPPSCKRPMDHGGYSVIFNINSSKGPLPIKRGPLPQSGCPPPKRYAPSGQVHINNGMEGKAPVQHGRDS*GGKT*K


Parental protein
EPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPR-DYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAP
.PLPS.RDVYLSP.DDGYSTKDSYS.RD.PSS.DTRD...PPR.DYTY.DYGHSSS.DDYPSRG.S.RD.YG.D..Y.DH.SG.SY.D.YESYGNS.SA.
Retrocopy
KPLPSHRDVYLSPKDDGYSTKDSYSMRDFPSSCDTRD*VLPPR\DYTYCDYGHSSSHDDYPSRGCSIRDDYGPDLNYLDHTSGSSYGD*YESYGNSLSAL


Parental protein
PTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSME-RGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGG-GRSRY
.T.GP.PS..G.S..DDYSSS.DGYGGS.DSYS.S.SDLYS.G.D..GRQERGLPPS.E.R.YPPP.DSY..S...APRGG..GGS.SDRG..GRSRY
Retrocopy
TT*GPLPSCRGNSHCDDYSSSYDGYGGSQDSYSGSGSDLYSRGHDLAGRQERGLPPSVE\RRYPPPCDSYTTSIHRAPRGGSYGGS*SDRGE/GRSRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide