RetrogeneDB ID:
retro_mputfur_960
Organism:
Location:
GL896981.1:4830627-4831142 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.41 %
Coverage:
98.29 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
TPT1
Parental gene aliases:
No gene alias available
Parental gene description:
tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:12022]

Genomic region (view in browser)





>retro_mputfur_960
GTGATCATCTCCTGGGACCTCATCCGCTAGGATGAGATGTTGTCCACCATCTACAAGATC
TGGGAGATGACACAGGGGCTGTGCCTGGAGGTGGAGGGGAGGATGGTCAGGAGGACAGAG
GGCAACACTGATGACTTGCTCATTGGTGGAAACGTCTCCACATGAGGCCCCGAGAGTGAA
GGTACAGAAAACCCAGTCACCGCTGGTGGTGATACTGTCCTGAACCATCACTTACGGAAA
CCAGCTGCACCAAAGAAGCCTACAAGAAGCACATCAAAGATTACATCAAATCAGTCAAAG
GCAAACTTGAAGAACAGCAGCCAGAAAGAGTAAAACCTTTTATGACAGGGGCTGCAGAAC
ACATCAAGCACATCCTTGCTAACTGCAAAAACTACCAGTTCTTTCCTGATGAAAACATGG
ACCGAGAGGGCATGGTTGCTCTGTGGGACTATTCTGAGGATGGCAGGACCCCACACAGGA
TTTTCTTTAAGGATGGTGTGGAAATGGAAAAATGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQ-ETSFTKEAYKKYIKDYMKSI
.II..DLI..DEM.S.IYKI.E...GLCLEVEG.MV.RTEGN.DD.LIGGN.S..GPE.EGTE..V..G.D.V.NHHL..ETS.TKEAYKK.IKDY.KS.
Retrocopy
VIISWDLIR*DEMLSTIYKIWEMTQGLCLEVEGRMVRRTEGNTDDLLIGGNVST*GPESEGTENPVTAGGDTVLNHHLR/ETSCTKEAYKKHIKDYIKSV


Parental protein
KGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
KGKLEEQ.PERVKPFMTGAAE.IKHILAN.KNYQFF..ENM...GMVAL.DY.EDG.TP..IFFKDG.EMEKC
Retrocopy
KGKLEEQQPERVKPFMTGAAEHIKHILANCKNYQFFPDENMDREGMVALWDYSEDGRTPHRIFFKDGVEMEKC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide