RetrogeneDB ID:
retro_mputfur_962
Organism:
Location:
GL896981.1:8304991-8305369 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.19 %
Coverage:
99.21 %
Frameshifts:
0
Stop codons:
4


Parental gene:
Parental gene symbol:
NUTF2
Parental gene aliases:
No gene alias available
Parental gene description:
nuclear transport factor 2 [Source:HGNC Symbol;Acc:13722]

Genomic region (view in browser)





>retro_mputfur_962
ATGGGAAATAAGTCAGTTGGGGAGCAGACTGAATCCAGCTTCATTCAACATTACTACCAG
TTATTTAATAATGACAGAATGCAACTAGGTGCCATTTATATTGACGCATCATGCCTCAGG
TGGGAAGGATAGCAATTCTAGGGGAAAGCTACCATTGTGGAGAGATTGTCTAGCCTTCTG
TTCCAGAAAATCTAGCACAGCCTCATGGCATGGGATCATCAGCCCATGCTAGATAGCCGC
ATCATCACCAGGGTTGTGGGCCAGCTCAAGGCTGATGAAGACCCCATGATGGGATTCCAC
GAGATATTCCTATTAAAGAACATGAAGGATGCTTGAGTTTGCACCAATGACATGTTCAGG
TTTGCCCTGCACAACTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFH
MG.K...EQ..SSFIQHYYQLF.NDR.QLGAIYIDASCL.WEG.QF.GKA.IVE.LSSL.FQKI.HS..A.DHQP..DS.II..VVGQLKADEDP.MGFH
Retrocopy
MGNKSVGEQTESSFIQHYYQLFNNDRMQLGAIYIDASCLRWEG*QF*GKATIVERLSSLLFQKI*HSLMAWDHQPMLDSRIITRVVGQLKADEDPMMGFH


Parental protein
QMFLLKNINDAWVCTNDMFRLALHNF
..FLLKN..DA.VCTNDMFR.ALHNF
Retrocopy
EIFLLKNMKDA*VCTNDMFRFALHNF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide