RetrogeneDB ID:
retro_mputfur_963
Organism:
Location:
GL896982.1:39444-42209 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
97.19 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
WWP1
Parental gene aliases:
No gene alias available
Parental gene description:
WW domain containing E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:17004]

Genomic region (view in browser)





>retro_mputfur_963
ATGGCCACTGCTTCACCACGGTCTGATATTAGTAATAACCACAGTGGAAGGTTACAGTTA
CAGGTAACTGTTTCTAGTGCCAAACTAAAAAGAAAAAAGAACTGGTTTGGAACAGCAGTA
TATACAGAAGTAATTGTAGATGGAGAAATTAAGAAAACAGCCACCCAGTAGTTCTTCTAA
TCCAAAATGGGATGAACAGCTAACCGTAAATGTGACCCCACAGTCTACTTTGGAATTTCG
AGTTTGGAGTCATTATACTTTAAAAGCCGATGCTTTATTAGGAAGAGCAACAATAGATCT
GAAACATGCTCTGTTAATACACAATAGAAAATTGGAAAGCGTGAAAGAACAATTAAAACT
TTCTTTGGAAAACAAGAATGGTATAGTGCAAACTGGTGAGTTAACAGTTGTGCTCGATGG
ACTGGTGATTGAGCAAGAAAATCTAACAAACTGCAGCACATCTCCAACCATAGAAATACA
GCAAAATGGTGATCAGCCTTAGTGAAAATGGAGACCCTTCAACAAGACCAACTTCCAGGT
TGGCTGTTGAAGGTACTAATGGGACAGATAATCATGCACCCACAAGCAGTCTAGTTCAAA
ACTCATGCTGTTCATATATAGTTAATGGAGACAGCACACCTTCATCTCCGTCTCTGGTTG
CTGCCAGACCCAAAACCACACCAGCTCCAAAACCACTCACATCTGAGCCTGCCAATGACA
CTGTTAATGGAGAATCATCCTCATCTGCACCAACCGATAATGCTTCCACCACGGGTACTG
CAATAGTATCTGAAGAAAATGCCTTGTCTTCAAATTGCACTAATACTACTGTTGAAGATC
CTCCAGTTCAAGAAATACTGACTTCCTCAGAAATCAATGAATGTATTCTTTCTAACAGTG
CAGCATTTGGATCTGAAACGAGAAGTACTTTAGATCTTGCTGCCTCTAATTCTGGAAATA
ATTCTGCCTTTGAGGCAGCCAAATTAAGACAGCCAGATGGGTGTGTGGAACCTGTACGGC
AGCAGTCTGGAAGTACCAACACAGAAACGTTGCCATCAGGGTGGGAACAGAGAAAAGATC
CTCATGGTAGAACTTACTACGTGGATCATAATACTCGAACGACTACGTGGGAGAGGCCAC
AGCCTTTACCTCCAGGTTGGGAAAGAAGAGTTGATGATCGTGGCAGAGTTTATTATGTGG
ATCATAACACCAGAACAACAACCTGGCAGTGGCCTACCATGGAGTCTGTTCGAAACTTTG
AGCAGTGGCAGTCTCAGCGGAACCAATTGCAAGGAGCTATGCAACAGTTCAACCAGAGAT
ACCTCTATTCGGCTTCAATGTTAGCTGCAGAAAATGACCCATATGGGCCTTTGCCACCAG
GCTGCGAAAAAAGAGTGGATTCAACCGACAGGGTTTACTTTGTGAATCATAACACAAAAA
CAACCCAGTGGGAAGATCCCAGAACTCAAGGCTTACAGAATGAAGAACCCCTGCCAGAAG
GCTGGGAAATTAGGTATACTCGGGAAGGTGTTAGGTACTTTGTTGATCATAATACAAGAA
CAACAACATTCAAAGATCCTCGCAATGGGAAATCATCTGTAACTAAAGGTGGTCCACAGA
TTGCTTATGAACGCAGCTTTAGATGGAAACTTGCTCACTTCCGTTATTTGTGCCAGTCTA
ATGCACTACCCAGTCATGTAAAGATCAATGTATCCAGGCAGACACTATTTGAAGATTCCT
TCCAACAGATTATGGCATTAAAACCCTATGACTTGAGAAGGCGATTATATGTAATATTTA
GAGGAGAAGAAGGACTTGATTATGGTGGTCTAGCAAGAGAATTGTTTTTCTTGCTTTCCC
ATGAAGTTTTGAACCCCATGTATTGCTTATTTGAGTATGCTGGCAAGAACAACTATTGTC
TTCAGATAAATCCAGCATCAACCATTAACCCAGACCATCTTTCATACTTCTGTTTTATTG
GTCGCTTTATTGCTATGGCACTTTTTCATGGGAAGTTTATTGATACTGGTTTCTCTTTAC
CACTCTACAAGCGTATGCTAAGTAAAAAACTGACTATTAAGGATTTGGAATCTATTGATA
CTGAATTTTACAACTCCCTTATCCGGATAAGAGATAACAACATTGAAGAATGTGGCTTAG
AAATGTACTTTTCTGTTGACATGGAAATTTTGGGAAAGGTTACTTCGCATGACCTGAAGT
TAGGAGGTTCCAATATCCTGGTGACTGAGGAGAACAAAGATGAATATATCGGTTTAATGA
CAGAGTGGCGTTTTTCTCGAGGAGTGCAGGAACAGACCAAAGCTTTCCTTGATGGTTTCA
ATGAAGTCGTCCCTCTTCAATGGCTGCAGTACTTTGATGAGAAAGAATTAGAGGTTATGG
TGTGTGGCATGCAGGAGGTTGACTTGGCAGATTGGCAGAGAAATACTGTGTATCGACATT
ATACAAGAAACAGCAAGCAAATCATTTGGTTTTGGCAGTTTGTGAAGGAGACAGACCATG
AAGTAAGGATGCGACTATTACAGTTTGTCACTGGAACCTGCCGTTTACCTCTAGGAGGAT
TTGCTGAGCTCATGGGAAGTAATGGGCCTCAAAAATTTTGCATTGAAAAAGTTGGCAAAG
ACACCTGGTTACCAAGAAGCCACACATGTTTTAATCGCTTGGATCTACCACCATCTAAGA
CTTATGAACAACTAAAGGAAAAACTTCTTTTTGCGATAGAAGAGACAGAGGGATTTGGAC
AAGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAVYTEVIVDGEIKKTA-KSSSSSNPKWDEQLTVHVTPQSTLEFRVWSHYTLKADALLGRATI
MATASPRSD.SNNHSGRLQLQVTVSSAKLKRKKNWFGTAVYTEVIVDGEIKKTA..SSS.SNPKWDEQLTV.VTPQSTLEFRVWSHYTLKADALLGRATI
Retrocopy
MATASPRSDISNNHSGRLQLQVTVSSAKLKRKKNWFGTAVYTEVIVDGEIKKTA\PSSS-SNPKWDEQLTVNVTPQSTLEFRVWSHYTLKADALLGRATI


Parental protein
DLKQALLIHNRKLESVKEQLKLSLENKNGIVQTGELTVVLDGLVIEQENLTNCSSSPTIEIQQNGD-ALHENGDPSTRPTSRLAVEGTNGTDNHAPTSSL
DLK.ALLIHNRKLESVKEQLKLSLENKNGIVQTGELTVVLDGLVIEQENLTNCS.SPTIEIQQNGD..L.ENGDPSTRPTSRLAVEGTNGTDNHAPTSSL
Retrocopy
DLKHALLIHNRKLESVKEQLKLSLENKNGIVQTGELTVVLDGLVIEQENLTNCSTSPTIEIQQNGD\SLSENGDPSTRPTSRLAVEGTNGTDNHAPTSSL


Parental protein
VQNSCCSYVVNGDSTPSSPSQVAARPKATPAPKPLTSEPANDTVNGESSSSAPTDNASTTGTAIVSEENALSSNCTNTTVEDPPVQEILTSSENNECILS
VQNSCCSY.VNGDSTPSSPS.VAARPK.TPAPKPLTSEPANDTVNGESSSSAPTDNASTTGTAIVSEENALSSNCTNTTVEDPPVQEILTSSE.NECILS
Retrocopy
VQNSCCSYIVNGDSTPSSPSLVAARPKTTPAPKPLTSEPANDTVNGESSSSAPTDNASTTGTAIVSEENALSSNCTNTTVEDPPVQEILTSSEINECILS


Parental protein
NSAAFGSETRSTLDLAASNSGNNSAFEAAKLRQPDGCGEPVRQQSGSTNTETLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVY
NSAAFGSETRSTLDLAASNSGNNSAFEAAKLRQPDGC.EPVRQQSGSTNTETLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVY
Retrocopy
NSAAFGSETRSTLDLAASNSGNNSAFEAAKLRQPDGCVEPVRQQSGSTNTETLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVY


Parental protein
YVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEEPL
YVDHNTRTTTWQ.PTMESVRNFEQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPG.EKRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEEPL
Retrocopy
YVDHNTRTTTWQWPTMESVRNFEQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGCEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEEPL


Parental protein
PEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYV
PEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYV
Retrocopy
PEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYV


Parental protein
IFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLES
IFRGEEGLDYGGLARE.FFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLP.YKRMLSKKLTIKDLES
Retrocopy
IFRGEEGLDYGGLARELFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPLYKRMLSKKLTIKDLES


Parental protein
IDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELE
IDTEFYNSLI.IRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELE
Retrocopy
IDTEFYNSLIRIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELE


Parental protein
VMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGLGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDL
VM.CGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETD.EVRMRLLQFVTGTCRLPLGGFAELM..GSNGPQKFCIEKVGKDTWLPRSHTCFNRLDL
Retrocopy
VMVCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDHEVRMRLLQFVTGTCRLPLGGFAELM--GSNGPQKFCIEKVGKDTWLPRSHTCFNRLDL


Parental protein
PPYKSYEQLKEKLLFAIEETEGFGQE
PP.K.YEQLKEKLLFAIEETEGFGQE
Retrocopy
PPSKTYEQLKEKLLFAIEETEGFGQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide