RetrogeneDB ID:
retro_mputfur_968
Organism:
Location:
GL896982.1:4455690-4456059 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.36 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
ZNRD1
Parental gene aliases:
No gene alias available
Parental gene description:
zinc ribbon domain containing 1 [Source:HGNC Symbol;Acc:13182]

Genomic region (view in browser)





>retro_mputfur_968
ATGGACCACGCATAGTCCAGCTCCAGGTTCCAGTCGGACCTGGACTTGTGTCCGGATTGT
GGCTCCCTCCTGCCACTGCCTGGGGCACAGGACACGGTCACCTGTGTTTGCTGTGGCTTC
CGTATCCCCATGCAAGACTTTAAGGGGAAGGTCGTGAACACCTGTGTCATGTTCAACAAA
CTGGGGACAGCCGTGCCTGTGTCAGTGGAGGAAGGGTTCGAGTTCCAGGGACCCGTGGTT
GAGAGGCGCTGCTCTCGATGTGCTCACAAAGGAATGGCCTAGCACACCAGACAGATGTGC
TCAGCCAGTGAGGGGCACACAATCTTCAATACCTGTACCAACTGCAGGTTCCTGGAGAAG
GAAGACTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDGARSGSRFQSDLDFCPDCGSVLPLPGAQDTVTCVRCAFRVPVRDFEGRAVSSCVVFNKPGTAAPAPAEEGPEFQGPVVDRRCPRCGHEGMAYHTRQMR
MD.A.S.SRFQSDLD.CPDCGS.LPLPGAQDTVTCV.C.FR.P..DF.G..V..CV.FNK.GTA.P...EEG.EFQGPVV.RRC.RC.H.GMA.HTRQM.
Retrocopy
MDHA*SSSRFQSDLDLCPDCGSLLPLPGAQDTVTCVCCGFRIPMQDFKGKVVNTCVMFNKLGTAVPVSVEEGFEFQGPVVERRCSRCAHKGMA*HTRQMC


Parental protein
SADEGQTVFYTCTRCRFQEKEDS
SA.EG.T.F.TCT.CRF.EKEDS
Retrocopy
SASEGHTIFNTCTNCRFLEKEDS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide