RetrogeneDB ID:
retro_mputfur_969
Organism:
Location:
GL896982.1:4861621-4861960 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.1 %
Coverage:
76.32 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
PLP2
Parental gene aliases:
No gene alias available
Parental gene description:
proteolipid protein 2 (colonic epithelium-enriched) [Source:HGNC Symbol;Acc:9087]

Genomic region (view in browser)





>retro_mputfur_969
ACCAACTTCCTGTGCACCCAGAAAGAACTTTCCTTCTTGCTGATATTATATTGTGCCTGG
TGATTCTCATCTGCTTCAGTGCCTTGACGCAGCCCTGAGGGCACTCCCTGTCAGTGGTTG
AGATGGTCCTCACCTTCTTCTGTCATATACATGTACGACCTGCACATCAAAATGCAGTTC
ATCTACTAGCCCTGAAGCGCTTTTTTCTGAATCCTCATTGTTGTGAACCATGAGCTGACC
ATGTCCACTGCTGTCCCCAGTAAACAAGGGAACCCCTCCAAAACTGTCACCAGGGTACCT
ATCACCAAGGGCCTCTTTGGCCATGATGACTACTCTACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TNFSRTRKGI-LLFAEIILCLVILICFSAST-PGYSSLSVVEMILAAIFF-VIYMCDLHTKIQIINWPWSDFFRTLIAAILYLITSIVVLVEGGNHSKII
TNF..T.K....L.A.IILCLVILICFSA.T.P...SLSVVEM.L...FF.VIYM.DLH.K.Q.I..P.S.FF..LI.....L..S..V....GN.SK..
Retrocopy
TNFLCTQKEL/FLLADIILCLVILICFSALTQP*GHSLSVVEMVLT--FF\VIYMYDLHIKMQFIY*P*SAFF*ILIVVNHELTMSTAVPSKQGNPSKTV


Parental protein
AGVLGLLATSLFGYDAYIT
..V.......LFG.D.Y.T
Retrocopy
TRV--PITKGLFGHDDYST


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide