RetrogeneDB ID:
retro_mputfur_971
Organism:
Location:
GL896982.1:7842597-7843150 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.54 %
Coverage:
90.91 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
ITPA
Parental gene aliases:
No gene alias available
Parental gene description:
inosine triphosphatase (nucleoside triphosphate pyrophosphatase) [Source:HGNC Symbol;Acc:6176]

Genomic region (view in browser)





>retro_mputfur_971
AAGCTGGAGGAGGTCATTCAGATTCTAGGAAATAGTTTCCATGATCTTGGGTGGCACAGA
AAATTGACCTGCCAGAGTTCCAGAGAGAGCCTGAGGAGATTTGTGTACAGAAGTGTCAGG
AAACAGCTCACCAGGTACAGGAGCTTGTACTGGTGGAGGACACCTAGCTGCTTCAATTCC
TTTGGGAGCCCCCTGGCCCCTACATAAAGTGGTTTCTGGAGAAGTTAAAGCCTGAAGGTC
TCTGCCAGCTCCTGCTGGGTTTGAGGACAGACTTGCCTGTGTGCTCTACACATTTGTGCT
CAGCACCAAGGACCCCAGCAAGCCAGTGCCCCTATTCAGGGACCAGATCGTGGTGCTCCA
AGGCCTCCAGAACTTTGGCTGAGACTCCTGCTTTCAGCCTGATGGATACAAGCAGACATA
TGCAAAGATGCCCAGAGCTGAGAAGAATGCCGCCTTCCATCACTTCCAGGCCCTGCCTGA
GCTACAAAAACACTTTTGCAGCTTGACTTTTCTGGTGGACATTGATGATTGCCCTGGCTG
GGGATCTGAGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KLEEVIQILGDKS-PCTLVAQKIDLPEYQGEPDEISIQKCQEAARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLYQLL-AGFDDKSAYALC
KLEEVIQILG....P...VAQKIDLPE.Q.EP.EI..QKCQE.A.QVQ..VLVEDT.L....L...PGPYIKWFLEKLKPEGL.QLL.AGF.D..A..L.
Retrocopy
KLEEVIQILGNSF/P*SWVAQKIDLPEFQREPEEICVQKCQETAHQVQELVLVEDT*L-LQFLWEPPGPYIKWFLEKLKPEGLCQLL/AGFEDRLACVLY


Parental protein
TFALSTGDPSEPVRLFRGRTSGQIVAPRGCRDFGWDPCFQPDGYEQTYAEMPKAEKNTISHRFRALLELQKYLGSLDAPVVGDDRPGRGTGE
TF.LST.DPS.PV.LFR.....QIV...G...FG.D.CFQPDGY.QTYA.MP.AEKN...H.F.AL.ELQK...SL...V..DD.PG.G..E
Retrocopy
TFVLSTKDPSKPVPLFR----DQIVVLQGLQNFG*DSCFQPDGYKQTYAKMPRAEKNAAFHHFQALPELQKHFCSLTFLVDIDDCPGWGSEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide