RetrogeneDB ID:
retro_mputfur_974
Organism:
Location:
GL896983.1:420990-421547 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.83 %
Coverage:
99.47 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_974
GGAGTCAACATTTGCCACAAGGATGGAAAGTTTTGGCTCAAAGATCCCAAGATCTAGAAC
ATCTGCCTGAGACTGCTAGACAAACTGTACATGTTTCTGGCCAGACAAACCAAATCCACC
TTTTACCAAATTGTGTTAAAGAGGTTGGTCATGAGTCTCACTAACTGGCCTCCTTTGCCC
TTTTACTGGATGATCCAGAAGATGAAGCTGCCTGGTCCAGAAGACAAAACATCTGTGGTT
GTAAGGACTATAATCCATGATGTGCGTGTCCAGGAGAAGCCCAATCTGAAGGTGTACGTA
CTGCTGGTGGGAAGCCATGCCCAGAGGAGCATCCTCAAAGCTAGGGGCAAGATCCTCACC
TTTGATCAATTGACCTTGGACTCCCCCCAGGGCTATGGCACCGTCTTGCTCTCCGGTCCA
CACAAAGGCCAAGAGTATACAGGAATTTTGGCAAGGCCCCAGGAGCACTGCCCAACCACA
CCAAACTCCACCTGCCACAGAGGGGCAGGAAATTAGGCTGTGCCAAAGGACACAGGGCCA
GCCTAGACTACAGAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVC
GV.I.H.KD.K...K.PK...I.LRLL.KLY.FLAR.T.STF.Q.VLKRL.MS.TN.PPL....MI.KMKLPG.E.KT.VVV.TI..DVRVQE.P.LKV.
Retrocopy
GVNICH-KDGKFWLKDPKI*NICLRLLDKLYMFLARQTKSTFYQIVLKRLVMSLTNWPPLPFYWMIQKMKLPGPEDKTSVVVRTIIHDVRVQEKPNLKVY


Parental protein
ALRVSSRARSRILKAGGKILTFDQLALDSPKGCGTVLLSGPRKGRE-VYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN
.L.V.S.A...ILKA.GKILTFDQL.LDSP.G.GTVLLSGP.KG.E.VYR.FGKAPG....HTK......GRK...A.G.RAS..Y.N
Retrocopy
VLLVGSHAQRSILKARGKILTFDQLTLDSPQGYGTVLLSGPHKGQE/VYRNFGKAPGALPNHTKLHLPQRGRKLGCAKGHRASLDYRN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide