RetrogeneDB ID:
retro_mputfur_990
Organism:
Location:
GL896987.1:242-513 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.74 %
Coverage:
66.91 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
H3F3B
Parental gene aliases:
No gene alias available
Parental gene description:
H3 histone, family 3B (H3.3B) [Source:HGNC Symbol;Acc:4765]

Genomic region (view in browser)





>retro_mputfur_990
GCACCGAGGAAGCAACTGGCTACAAAAGCCACCTGCCAGAGTGCGCCCTCTACTGGAGAG
ATGAAGAAACCTCGCCGTTACAGGCTCGGTACTGCGGCGCGCCGCCCAAAGGAGACGTTA
GCAGAAGTCCACTGAACTGATCCGCAGACTTCCTCTCCAGCGTCTGGCGCAAGAAGTAGC
TCAGGACTTCAGAACAGATCTGCGCTTCCAGAGGGCAGCTGTAGGCGCTTGGCAGGAGGC
AAGCGAGGCCTCTCTCGAGGTCCTCTTTGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
APRKQLATKAARKSAPSTGGVKKPHRYRPGTVALR-EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE
APRKQLATKA...SAPSTG..KKP.RYR.GT.A.R...RR.QKSTEL.IR.LP.QRL..E.AQDF.TDLRFQ.AA.GA.QEASEA.L..LFE
Retrocopy
APRKQLATKATCQSAPSTGEMKKPRRYRLGTAARR\QRRR*QKSTEL-IRRLPLQRLAQEVAQDFRTDLRFQRAAVGAWQEASEASLEVLFE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide