RetrogeneDB ID:
retro_mputfur_993
Organism:
Location:
GL896987.1:6656453-6656743 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.59 %
Coverage:
80.83 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
GABARAPL2
Parental gene aliases:
No gene alias available
Parental gene description:
GABA(A) receptor-associated protein-like 2 [Source:HGNC Symbol;Acc:13291]

Genomic region (view in browser)





>retro_mputfur_993
ATGAAGCAGATGTTCAAGGAGGAACACTTGTTGGAATACAGATGTGTACAATCTGTGAAG
ACCCAAGTGAAATATCCCAACCAGGTTCCAGTGATTGTGGAAAAAGTCTCAGGCTCTCAG
ATTGTTGACAATGACAAACAGAAGTATCTGGTTCCATCTGACATCACTGTGGCTCAGTTC
ATGGGGATCATCAGGAAAAGAAGCCAGCTTCCCTCTGAAAAGGCAATTTTCCTATTTGTG
GGCAAACTGTCCCACAGTCCAGCCTAACTAAGGGACAGCTTTAGAAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDK-TVPQSSLTMGQLYEK
MK.MFKE.H.LE.RCV.S.K...KYP..VPVIVEKVSGSQIVD.DK.KYLVPSDITVAQFM.IIRKR.QLPSEKAIFLFV.K.TVPQSSLT.GQL..K
Retrocopy
MKQMFKEEHLLEYRCVQSVKTQVKYPNQVPVIVEKVSGSQIVDNDKQKYLVPSDITVAQFMGIIRKRSQLPSEKAIFLFVGK/TVPQSSLTKGQL*KK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide