RetrogeneDB ID:
retro_mputfur_994
Organism:
Location:
GL896987.1:6668248-6668551 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
58.49 %
Coverage:
86.44 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
ATP6V1G1
Parental gene aliases:
No gene alias available
Parental gene description:
ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864]

Genomic region (view in browser)





>retro_mputfur_994
AAGGAGGCCACAGAGAAGGTGTCTGAGGCCAACAAGCAAAGAACCCTGAGGCCAAAGGAG
GCCAAAGCAGCTCAGGCTAAAATTGAACAACATCACCTGCAGAGGAAGAAAGAGTTCAAG
GACAAGGAGACTACAATTCTTGGATCCCAGTACAGCACTGAAGTGGAGAAGACCCAGGGG
ATGACCATCCTCCAGAACTACTTCCAGAAAAACACAGATTAAGTCCTGGAAAACCTTTCA
GTCTTTGTCTGCAACATCCTACCCCTTGAATTTTCAGAAATTCAAGAAAATTGTCTCATT
AAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSTEVEKETQEKMTILQTYFQQNRDEVLDNLLAFVCDIRP----EIH
K.A.EKVSEA.K....R.K.AK..AQA.IEQ..LQR.KEFK.KE...LGS....STEVEK.....MTILQ.YFQ.N.D.VL.NL..FVC.I.P....EI.
Retrocopy
KEATEKVSEANKQRTLRPKEAKA-AQAKIEQHHLQRKKEFKDKETTILGSQ--YSTEVEKT--QGMTILQNYFQKNTD*VLENLSVFVCNILPLEFSEIQ


Parental protein
ENYRIN
EN..IN
Retrocopy
ENCLIN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide