RetrogeneDB ID:
retro_mputfur_997
Organism:
Location:
GL896988.1:2764665-2765124 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.58 %
Coverage:
91.07 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
NME1
Parental gene aliases:
No gene alias available
Parental gene description:
NME/NM23 nucleoside diphosphate kinase 1 [Source:HGNC Symbol;Acc:7849]

Genomic region (view in browser)





>retro_mputfur_997
ACCATGGCCAACAGTGAACGCACCTTCATTGCCATCAAGCCTGATGGGTTGCAGTGCAGC
CTTGTGGGAGAAATCATCAAGCGTTTTGAGCAAAAGGGATTCCGCCCCATTGCTATGAAA
TTAATTCAGACTTCTGAAGACCTTCTCAAGGAGCACTACATCGACCTGAAGGATCGTCCC
TTCTTGGCTGGCTTGCTCAAGTACATGCAGTCATGGCCCGTGGTTGTCATAGTCTGGGAG
GGCCTGAACGTGGTGAAGACAGGCCGAGTGATGCTTGGGGAGACCAACCCTCCAGACTCC
AAGCTTGGGACCATTCGTGGGGACTTCTGCATCCAAGTTGGCAGGAACATTATCCACGGC
AAAGACTCCGTGGAGAGTGCGGAGAAGGAGATTGGCTAATGGCTCCAGCCTGAAGAGCTG
GTGTATTACAAGAGGTGTGCTCAGAGCTGGATCTACGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TMASCERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLVAMKLIQASEDLLKEHYIDLKDRPFFAGLVKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADS
TMA..ERTFIAIKPDG.Q.SLVGEIIKRFEQKGFR..AMKLIQ.SEDLLKEHYIDLKDRPF.AGL.KYMQS.PVV..VWEGLNVVKTGRVMLGETNP.DS
Retrocopy
TMANSERTFIAIKPDGLQCSLVGEIIKRFEQKGFRPIAMKLIQTSEDLLKEHYIDLKDRPFLAGLLKYMQSWPVVVIVWEGLNVVKTGRVMLGETNPPDS


Parental protein
KPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFQPEELVDYKSCAQSWIYE
K.GTIRGDFCIQVGRNIIHG.DSVESAEKEIG.W.QPEELV.YK.CAQSWIYE
Retrocopy
KLGTIRGDFCIQVGRNIIHGKDSVESAEKEIG*WLQPEELVYYKRCAQSWIYE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide