RetrogeneDB ID:
retro_olat_15
Organism:
Medaka ( Oryzias_latipes )
Location:
5:26944600-26945578 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.38 %
Coverage:
73.7 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
mafba
Parental gene aliases:
No gene alias available
Parental gene description:
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein B (avian) [Source:ZFIN;Acc:ZDB-GENE-980526-515]

Genomic region (view in browser)





>retro_olat_15
GCCAGCTGCAGTTTCATGAGCTCTGAGGCGCTTTCACATCTAAAAATCCCCATGGATTTC
GTGGGCGACTTTGACTTGATGAAATTCGGCGTGAAGAAGGAGACGATGCAGAGTCTGGAA
CGCGCATTCGTCGGGCCGTGCAGTCAGCTCCAAAGGCCAGACTCCGTCTCCTCCACCCCT
GGCACCACTCCGTGCAACTCGGTGCCCTCCTCTCCAAACATCAACCCGCACGAGCAGAGA
AACACCCCCGGGGGCGACCACTTCTGGATGCACAACAACGGCGGATACCCTCATCAGATG
TACCCCCAAGCTTTTGGTCTGACCCCCGAGGACGCAATGGAGGCCCTCATTGACGCGACG
CAGCAGGGGCACCCCACTGCGCCCCACATCCACCACCCTCAGCCCTTCCAGGGTGACTAC
GAGGGCTACGCTCACCTGAACGAGCCTGTCCACCACTACGCGGGCCTCCCCGGTCACCCC
GACATGCAGGGCGTCCCGAGCAGCCACTGCCAGGACACATATCTCAAGGATGAAATCGGG
TGCGAGTCCCCGCAGTCGCCGGAGGCCCAGCAGGTCGTGGGTGCGCACCACCCTCTCCAG
CAACCGCACCGGCGATCCACCAGCGAGATGCACTTCTCAGACGACCAGCTGGTGTCCATG
TCCGTCAGAGAGCTGAATCGGCTGCTGAGGGGCCTGAGCAAGGACGAGGTGATGCGTCTG
AAGCAGAAGCGGCGGACCTTGAAAAACAGAGGTTACGCACAGTCCTGCCGCTACAAGCGG
GTGCAGCAGAAACACATCCTGGAGCACGAAAAGACCAGCCTGGTGTCACAGGTCGAGCAG
CTGAAACACGAACTCAGCAGGCTGGTCCGAGAGAGGGACGCATACAAACTCAAATGTGAG
AAACTGTCCGGGGCGAACTGCTACCACGAAACCGGCTCCACCAGTGACAACCCGTCTTCT
CCTGAGTATTTAATATGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YWMPNSG-YHQQIDPQTLNLTPEDAVEALIGATAHGHPPPPHVQQQLQQQGAFEGYRGPYAGSMQHHTEELSGHPGGHNHPHGQHHHHHSQDPES-PSPV
.WM.N.G.Y..Q..PQ...LTPEDA.EALI.AT..GHP..PH.......QG..EGY.........HH...L.GHP.....P..........D.....SP.
Retrocopy
FWMHNNGGYPHQMYPQAFGLTPEDAMEALIDATQQGHPTAPHIHHPQPFQGDYEGYA--HLNEPVHHYAGLPGHPDMQGVPSSHCQDTYLKDEIGCESPQ


Parental protein
SPEAHQTLSQSAAHHSSGSGLSVEDRFSDEQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRFKRVQQKHVLENEKTQLMNQVEQLKAEI
SPEA.Q.................E..FSD.QLVSMSVRELNR.LRG..KDEV.RLKQKRRTLKNRGYAQSCR.KRVQQKH.LE.EKT.L..QVEQLK.E.
Retrocopy
SPEAQQVVGAHHPLQQPHRRSTSEMHFSDDQLVSMSVRELNRLLRGLSKDEVMRLKQKRRTLKNRGYAQSCRYKRVQQKHILEHEKTSLVSQVEQLKHEL


Parental protein
SRLARERDAYKLKCEKLTGSGATNGFREAGSTSDNPSSPEFFM
SRL.RERDAYKLKCEKL.G....N...E.GSTSDNPSSPE...
Retrocopy
SRLVRERDAYKLKCEKLSGA---NCYHETGSTSDNPSSPEYLI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide