RetrogeneDB ID:
retro_olat_17
Organism:
Medaka ( Oryzias_latipes )
Location:
24:11811604-11817409 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.94 %
Coverage:
99.79 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
vmhc (1 of 2)
Parental gene aliases:
No gene alias available
Parental gene description:
ventricular myosin heavy chain [Source:ZFIN;Acc:ZDB-GENE-991123-5]

Genomic region (view in browser)





>retro_olat_17
ATGGGCGATGCACTGATGGCTGAATTTGGAAAGGCTGCTCCTTTTCTGAGGAAGTCAGAC
AGGGAGCGTTTGGAGGCTCAGACCAAGCCTTTTGACATCAAAACGGAATGCTTTGTCGTC
GATGATAAGGTGGAATTCATGAAAGGACAGATCCAGAGCAAAGATGGAGGGATGGTGACT
GTGAAAAAGGAGGATGGAAACACTGTGACTGTGAAAGAGTCAGACGTTCATCCCCAGAAC
CCGCCAAAGTTTGATAAGATTGAAGACATGGCAATGTTTACTTTCCTACATGAACCAGCC
GTGCTGTTTAACCTCAAAGAGCGTTATGCTGCCTGGATGATCTACACCTATTCTGGGTTG
TTCTGCGTCACTGTCAATCCATACAAATGGCTGCCTGTCTACGACTACGATGTGGTGGCC
GCCTACAGAGGAAAGAAAAGGAGTGAGGCCCCTCCACACATCTTTTCCATCTCTGATAAT
GCTTACCAGTACATGCTGACAGACAGGGAGAACCAGTCCGTCCTCATCACCGGAGAATCC
GGAGCAGGGAAGACGGTGAACACCAAGCGAGTCATCCAGTATTTTGCGAGCATCGCTGCA
GTGGGAGGTGCAGGAAAAAAAGATAGCAGCAAGGGTACATTGGAGGATCAAATCATTCAG
GCAAACCCTGCACTTGAGGCCTTTGGGAATGCCAAAACGGCGAGAAATGACAACTCTTCT
CGTTTTGGTAAATTCATCCGTATTCATTTTGGCACAAGTGGCAAACTGTCATCTGCCGAC
ATTGAAACATACCTGCTGGAGAAGTCCCGTGTCACCTTTCAGCTCAAGGCTGAAAGGAAT
TATCACATCTTCTACCAGATCCTGTCCAATCAAAAGCCAGAGCTGCTGGACCTGCTGCTC
ATAACAAACAACCCATACGACTATTCCTACATCTCCCAAGGAGAGGTAACTGTTGCCTCC
ATCAATGACTCGGAGGAGCTGATGGCCACTGACAGTGCCTTTGATGTCCTTGGCTTCACT
CAAGAGGAGAAAATGGGTGTCTACAAGTTGACCGGTGCCATAATGCACTACGGCAACATG
AAGTTCAAACAGAAGCAGCGGGAGGAGCAGGCTGAACCTGACGGCACAGAGGCTGCTGAT
AAATCAGCTTACCTAATGGGGCTGAACTCTGCAGACCTCATTAAAGGACTCTGTCATCCC
AGAGTTAAGGTTGGAAATGAATACGTCACCAAAGGCCAAGGTGTAGATCAAGTCTACTAC
GCCATTGGCGCTCTGGCAAAATCAGTGTATGAGAAAATGTTTAACTGGATGGTGGTTAGA
ATTAACCAGTCCCTTGACACCAAGCAGGATCGTCAATACTTCATAGGAGTTCTTGACATT
GCTGGATTTGAGATTTTTGATTTCAACACCTTTGAGCAGCTGTGCATCAACTACACCAAT
GAGAAACTGCAACAGTTTTTCAACCATCATATGTTTGTTTTGGAGCAAGAAGAATACAAA
AAAGAAGGAATTGAATGGGAATTCATTGACTTTGGGATGGACCTGCAGGCCTGTATTGAC
CTGATTGAGAAGCCTATGGGGATTTTGTCCATCCTTGAGGAGGAATGTATGTTTCCAAAG
GCCAGTGACCAGACCTTTAAGGCAAAGCTCTACGATAATCATCTGGGCAAGAACAAGATG
TTTGAGAAGCCTAGGGCAGCAAAGGGGAAGGCAGAAGCTCATTTTGCTCTTGTTCACTAT
GCAGGCACGGTAGATTACAACATTAGTGGCTGGCTGGTCAAAAACAAAGACCCCTTAAAC
GAAACCGTGGTTGGGCTCTACCAGAAATCCTCCCTGAAGCTGCTAAGTGTTTTGTTTTCT
AATTATTCAGGAACGGATGGTGGAGATAAAGGAGGTAGCAAGGGGGCAAAAAAGAAAGGG
TCATCATTTCAGACAGTATCTGCCCTTCACAGGGAAAACCTGAACAAGCTCATGACCAAT
CTTAAAACCACTCATCCCCACTTTGTCCGTTGTCTAATTCCCAATGAGAAGAAAATTCCA
GGGGTCATGGATAATTGCCTTGTAATGCACCAACTGCGCTGTAATGGTGTACTGGAAGGC
ATCAGGATCTGCAGGAAAGGTTTCCCAAACAGGGTACTCTATGGAGACTTTAAGCAACGC
TACAGGATACTGAATGCCTCTGCAATCCCAGAAGGTCAGTTCATTGACTGCAAGAAAAGT
GCTGAGAAGTTACTCGGATCACTGAGCATTGATCATACTCAGTACAAGTTTGGCCACACT
AAAGTTTTCTTTAAAGCAGGACTGCTAGGAACCCTGGAGGAAATGAGAGATGAGCAACTC
TCTCGCATCATTACAAGGATCCAGGCAAATGCAAGAAGACTCCTCATGAGGGAGCAGTTT
GTGAAACTTGTGGAACGTCGAGATGCCCTGATGGTCATACAGTGGAATCTCCGGTCTTTT
CTTGGTGTGAAAAACTGGCCGTGGATGAAGCTCTTTTTCAAGATCAAACCCCTGCTTAAA
AGTGCCGAATCTGAAAAGGAGATGGCCAACATGAAAGATGAATTCAACAAGTTGAAAGAA
GCAATGGAGAAATCTGAAACAAGGAGGAAAGAGCTAGAAGAGAAAATAGTGACTCTTCTC
CAAGAAAAGAATGATCTGACTCTGCAAATTCAATCTGAGCAGGACACTCTGACAGATGCT
GAGGAACGCTGTGAACAGCTGATTAAGAGCAAGATTCAACTGGAGGCCAAACTAAAAGAG
ATGAACGAGAGGTTGGAGGATGAGGAGGAGCTGAATGCAGATCTCACAGCAAAGAAACGC
AAACTTGAAGATGAATGTTCTGAACTAAAGAAAGATATTGATGACCTTGAGTTAACGCTA
GCAAAAGTGGAAAAAGAGAAACACGCCACAGAGAACAAAGTAAAAAACCTAGTAGAAGAG
ATAGCTTCTCAAGATGAAAACATCTTGAAGCTGACCAAAGAGAAAAAGGCTCTGCAGGAG
GCCCATCAGCAGACACTGGATGACCTCCAGAGTGAAGAGGACAAAGCCAACAGCCTTACC
AAAGCAAAAGCTAAACTGGAGCAGCAAGTGGATGATCTAGAGGGATCACTTGAGCAAGAG
AAGAAAGTCAGAATGGATCTTGAACGCTCAAAGAGAAAGTTGGAGGGGGATCTGAAACTA
ACTCAAGAAAATATGATGGACCTGGAGAATGACAAGCAGCAGCTAGAAGAAAAACTCAAG
AAGAAAGACTTTGAGATCTCTCAAGTAAACTCAAAACTAGAAGACGAGCAAACCAATTCA
GTTCAGCTGCAAAAGAAGCTGAAAGAAAGTCAGGCAAAAATTGAGGAGCTTGAAGAAGAG
TTGGATGCAGAACGTGCAGCGCGAGCAAAAGTGGAGAAGCAGCGCTCAGAATTGTCCCGT
GAGCTGGAGGACATCAGTGAACGTTTGGAGGAAGTTGGCGGAGCCACATCAGCTCAAGTG
GAGCTAAATAAAAAGAGAGATGCTGAGTTTCAGAAGCTGCGAAGGGAGTTTGAAGAGTCA
ACTCTCCAACACGAGGCCACTGCTGCCGCCCTAAGAAAGAAGCATGCTGACAGTGTTGCT
GAACTGGGGGAACACATTGATAATCTGCAGCGTGTCAAGCAGAAACTGGAAAAAGAAAAG
AATGAGCTCAAGCTGGAGCTGGATGACTTGTCTTCAAGCATGGAGAGTGTTGTCAAGTCC
AAAGCCAACATTGAAAAGATGTGTCGTACATTAGAAGACAATATGAATGAGTATAAATGT
AAATTTGAGGAGGCTCAAAGGACCATCAACGACTTAACCACCCAAAGGGCTAGATTACTT
ACTGAAAATGGAGAGTTTGGACGTCAGCTAGAGGAGAAGGAAAGTCTCATATCACAGCTA
ACCAGAGGAAAAAACTCCTACAACCAGCAGGTGGAAGATCTGCGGAGACAGTTGGAGGAA
GAAGTAAAGGCAAAGAATGCCCTTGCCCATGCTGTTCAGTCAGCTCGACATGACTGCGAT
CTACTCCGAGAACAGTTCGAAGAGGAGCAGGAAGCCAAAGCTGAGCTACAGAGAGCCCTG
TCCAAATCCAACACGGAAGTTGCGGCATGGAGGACTAAATACGAGACGGATGGAATCCAA
AGAACAGAAGAGCTGGAGGAAGCGAAAAAGAAGCTGGTCCAGAGGTTGCAAGAGGCAGAG
GAGGCCATTGAGGCAGTGAATGCAAAGTGTTCATCGCTAGAGAAGACCAAACATCGCCTT
CAAAATGAGATTGAAGATCTCATGTTGGATCTGGAAAGGTCAAATGCAGCATCAGCAGCA
CTGGACAAAAAGCAAAGAACCTTTGACAAAGTCCTGGCAGAGTGGAAGCAGAAGTTTGAA
GAGTCACAGTCTGAATTGGAGGCCTCACAGAAGGAGAGTCGTTCTCTAAGCACTGAACTC
TTCAAACTTAAGAATGCCTTTGAGGAGTCACTGGATCAACTTGAAACAATTAAAAGAGAG
AACAAGAACCTCCAGGAGGAAATCTCTGACCTCACTGATCAGCTTGGAGAAGGTGGCCGC
AGTGCCCATGAGCTAGAAAAGATCAGAAAGCAGCTTGAACAAGAAAAGAACGAGCTCCAA
TCAGCTCTTGAGGAGGCAGAAGGATCTCTGGAGCATGAAGAAAGCAAGATCCTCAGAGCC
CAGCTTGAATTCAACCAAGTAAAGGCTGAGATAGAGCGCAAGCTAGCAGAGAAGGATGAG
GAAATGGAGCAAGCCAAGAGAAACTACCAACGGATGCTTGAGTCGCTTCAATCCTCTTTG
GATTCTGAGACCAGGAGTCGAAATGAGGCCCTGAGAGTCAAGAAGAAGATGGAGGGTGAC
CTCAATGAGATGGAGATACAGCTAAATCAAGCAAACAGGCAGGCAGCCGATGCCCAGAAG
CAGGTCAAGACCCTCCAGGGGTTCCTTAAAGACGCACAGCTACAGCTTGATGATACCCAG
CACTCCAATGATGACTTAAGAGAAAACATCACTCTACTGGAACGCCGAAACAACTTGATC
CAGAGTGAGTTGGAGGAGCTGAGAGCCGCTCTTGAGCAGACAGAGAGAAGTCGGAAACTG
GCCGAGCAGGAACTGACTGATGCAACAGAGAGGATCCAGCTGCTGCACTCCCAAAACACC
AGCCTGATTAACCAGAAAAAGAAGCATGAAGCAGATCTGCTCAACCTGCAGAATGAGATA
GAGGAGATCATACAGGAGCACCGCAATGCAGAGGAGAAGGCAAAGAAGGCAATTACGGAT
GCAGCCATGATGGCAGAGGAGCTAAAGAAGGAGCAGGACACCAGTGCACACTTGGAGCGC
ATGAAAAAGAACATGGAACAGACAATCAAAGACCTGCAACACCGTCTCGATGAGGCAGAA
CAGATCGCCATGAAAGGTGGTAAGAAGCAGGTCCAGAAACTGGAAGCTCGTATTCGGGAG
CTGGAGAATGAACTGGATGCAGAGCAGAAGAGGGGAACCGAGTCCATTAAAGGAGTGCGG
AAATATGAACGTAGGATTAAAGAGCTCACCTACCAGACCGAGGAGGACCGCAAGAACCTG
GCACGCCTGCAAGACCTTGTCGACAAGCTGCAATTGAAGGTGAAGTCCTACAAGCATGCA
GCTGATGAAGCAGAGGAGGCAGCCAATGCCAACATGGCCAAGGTCCGTAAGCTGCAGCAT
GAGCTAGAGGAGGCAGAGGAGAGGGCAGATATTGCCGAAGCACAAGTTAATAAGCTGAGG
GCCAAGACCAGAGACGGATCCTCCAAGAAGAACATGGACGAGTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGDAAMKEFGAAAPYLRKSDRERLEAQTRPFDMKRECFVPDPEEEYVKASIVSREGDKVTAQTAKGKTVTVKECDVHPQNPPKFDKIEDMAMFTFLHEPA
MGDA.M.EFG.AAP.LRKSDRERLEAQT.PFD.K.ECFV.D...E..K..I.S..G..VT.....G.TVTVKE.DVHPQNPPKFDKIEDMAMFTFLHEPA
Retrocopy
MGDALMAEFGKAAPFLRKSDRERLEAQTKPFDIKTECFVVDDKVEFMKGQIQSKDGGMVTVKKEDGNTVTVKESDVHPQNPPKFDKIEDMAMFTFLHEPA


Parental protein
VLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAA
VLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVY...VV.AYRGKKRSEAPPHIFSISDNAYQYMLTDRENQS.LITGESGAGKTVNTKRVIQYFASIAA
Retrocopy
VLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYDYDVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSVLITGESGAGKTVNTKRVIQYFASIAA


Parental protein
--GGGKKDAGTEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFAASGKLASADIETYLLEKSRVTFQLRAERDYHIFYQILSQKKPELLE
..G.GKKD.....KGTLEDQIIQ.NPALEAFGNAKT.RNDNSSRFGKFIRIHF..SGKL.SADIETYLLEKSRVTFQL.AER.YHIFYQILS..KPELL.
Retrocopy
VGGAGKKDSS---KGTLEDQIIQANPALEAFGNAKTARNDNSSRFGKFIRIHFGTSGKLSSADIETYLLEKSRVTFQLKAERNYHIFYQILSNQKPELLD


Parental protein
MLLITNNPYDYAFISQGETTVASINDAEELLATDEAFDVLGFTQDEKNGIYKLIGAIMHFGNMKFKNKQREEQAEADGTEDADKVAYLMGLNSADLIKGL
.LLITNNPYDY..ISQGE.TVASIND.EEL.ATD.AFDVLGFTQ.EK.G.YKL.GAIMH.GNMKFK.KQREEQAE.DGTE.ADK.AYLMGLNSADLIKGL
Retrocopy
LLLITNNPYDYSYISQGEVTVASINDSEELMATDSAFDVLGFTQEEKMGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEAADKSAYLMGLNSADLIKGL


Parental protein
CHPRVKVGNEWVTKGQNVQQVYYAVGALSKSVYEKMFLWMVVRINHSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQE
CHPRVKVGNE.VTKGQ.V.QVYYA.GAL.KSVYEKMF.WMVVRIN.SLDTKQ.RQYFIGVLDIAGFEIFDFNTFEQLCIN.TNEKLQQFFNHHMFVLEQE
Retrocopy
CHPRVKVGNEYVTKGQGVDQVYYAIGALAKSVYEKMFNWMVVRINQSLDTKQDRQYFIGVLDIAGFEIFDFNTFEQLCINYTNEKLQQFFNHHMFVLEQE


Parental protein
EYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSSNFQKPRNVKGKPEAHFALVHYAGTVDYNINNWLVKNKD
EYKKEGIEW.FIDFGMDLQACIDLIEKPMGI.SILEEECMFPKASD.TFKAKLYDNHLGK...F.KPR..KGK.EAHFALVHYAGTVDYNI..WLVKNKD
Retrocopy
EYKKEGIEWEFIDFGMDLQACIDLIEKPMGILSILEEECMFPKASDQTFKAKLYDNHLGKNKMFEKPRAAKGKAEAHFALVHYAGTVDYNISGWLVKNKD


Parental protein
PLNETVVGLFQKSTLKLLANLFANYAGVDSAETGKSGKGGGSKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRC
PLNETVVGL.QKS.LKLL..LF.NY.G.D....G.S....G.KKKGSSFQTVSALHRENLNKLMTNL..THPHFVRC.IPNE.K.PG.M.N.LVMHQLRC
Retrocopy
PLNETVVGLYQKSSLKLLSVLFSNYSGTDGGDKGGSK---GAKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCLIPNEKKIPGVMDNCLVMHQLRC


Parental protein
NGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSRKGAEKLLGSLEIDHNQYKFGHTKVFFKAGLLGQLEEMRDDRLSLIITGIQARSRGL
NGVLEGIRICRKGFPNR.LYGDFKQRYRILN..AIPEGQFID..K.AEKLLGSL.IDH.QYKFGHTKVFFKAGLLG.LEEMRD..LS.IIT.IQA..R.L
Retrocopy
NGVLEGIRICRKGFPNRVLYGDFKQRYRILNASAIPEGQFIDCKKSAEKLLGSLSIDHTQYKFGHTKVFFKAGLLGTLEEMRDEQLSRIITRIQANARRL


Parental protein
LARVEFQKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVHAEQ
L.R..F.K.VERRDAL.VIQWN.R.F.GVKNWPWMKL.FKIKPLL.SAE.EKEMANMK.EF.KLKEA..KSE.RRKELEEK.V.LLQEKNDL.LQ...EQ
Retrocopy
LMREQFVKLVERRDALMVIQWNLRSFLGVKNWPWMKLFFKIKPLLKSAESEKEMANMKDEFNKLKEAMEKSETRRKELEEKIVTLLQEKNDLTLQIQSEQ


Parental protein
DNLADAEERCEGLIKHKIQAEAKVKELTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLVEEMAALDEIIAKLTKE
D.L.DAEERCE.LIK.KIQ.EAK.KE..ERLEDEEE.NA.LTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLVEE.A..DE.I.KLTKE
Retrocopy
DTLTDAEERCEQLIKSKIQLEAKLKEMNERLEDEEELNADLTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLVEEIASQDENILKLTKE


Parental protein
KKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTLESLMDLENDKQQLEEHLKKKDFELSQLNNKIE
KKALQEAHQQTLDDLQSEEDK.N.LTKAKAKLEQQVDDLEGSLEQEKKVRMDLER.KRKLEGDLKLT.E..MDLENDKQQLEE.LKKKDFE.SQ.N.K.E
Retrocopy
KKALQEAHQQTLDDLQSEEDKANSLTKAKAKLEQQVDDLEGSLEQEKKVRMDLERSKRKLEGDLKLTQENMMDLENDKQQLEEKLKKKDFEISQVNSKLE


Parental protein
DEQAISIQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATTTQIEMNKKREAEFQKLRRDLEEATLHHESTTASLRKK
DEQ..S.QLQKKLKE.QA.IEELEEEL.AERAARAKVEKQR..L.RELE.ISERLEE.GGAT..Q.E.NKKR.AEFQKLRR..EE.TL.HE.T.A.LRKK
Retrocopy
DEQTNSVQLQKKLKESQAKIEELEEELDAERAARAKVEKQRSELSRELEDISERLEEVGGATSAQVELNKKRDAEFQKLRREFEESTLQHEATAAALRKK


Parental protein
QADSVADLGEQIDNLQRVKQKLEKEKSELKLELDDVVSNMEHVVKTKTNLEKTCRTLEDQMNEYKNKFEEAQRCINDFNMQKAKLQTENGELSRQLEDKD
.ADSVA.LGE.IDNLQRVKQKLEKEK.ELKLELDD..S.ME.VVK.K.N.EK.CRTLED.MNEYK.KFEEAQR.IND...Q.A.L.TENGE..RQLE.K.
Retrocopy
HADSVAELGEHIDNLQRVKQKLEKEKNELKLELDDLSSSMESVVKSKANIEKMCRTLEDNMNEYKCKFEEAQRTINDLTTQRARLLTENGEFGRQLEEKE


Parental protein
SKVSQLTRGKMSYTQQIEDLKRQLEEESKAKNALAHAVQSARHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQ
S..SQLTRGK.SY.QQ.EDL.RQLEEE.KAKNALAHAVQSARHDCDLLREQ.EEEQEAKAELQR..SK.N.EVA.WRTKYETD.IQRTEELEEAKKKL.Q
Retrocopy
SLISQLTRGKNSYNQQVEDLRRQLEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRALSKSNTEVAAWRTKYETDGIQRTEELEEAKKKLVQ


Parental protein
RLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLSEWKQKYEESQCELESSQKDGRALSTELFKLKNSYEESLDHL
RLQEAEEA.EAVNAKCSSLEKTKHRLQNEIEDLM.D.ERSNAA.AALDKKQR.FDKVL.EWKQK.EESQ.ELE.SQK..R.LSTELFKLKN..EESLD.L
Retrocopy
RLQEAEEAIEAVNAKCSSLEKTKHRLQNEIEDLMLDLERSNAASAALDKKQRTFDKVLAEWKQKFEESQSELEASQKESRSLSTELFKLKNAFEESLDQL


Parental protein
ETMRRENKNLQEEVSDLTEQLGESSKNIHELEKLRKQLEQEKSEIQSALEEAEASLEHEEGKILRTQLEFNQIKAEIERKLAEKDEEMEQSKRNMQRTID
ET..RENKNLQEE.SDLT.QLGE.....HELEK.RKQLEQEK.E.QSALEEAE.SLEHEE.KILR.QLEFNQ.KAEIERKLAEKDEEMEQ.KRN.QR...
Retrocopy
ETIKRENKNLQEEISDLTDQLGEGGRSAHELEKIRKQLEQEKNELQSALEEAEGSLEHEESKILRAQLEFNQVKAEIERKLAEKDEEMEQAKRNYQRMLE


Parental protein
TLQSSLEAECRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKAVHAHLKDCQIQLDESVRANDDLKENLAIIERRNNLLQAELEELRAALEQT
.LQSSL..E.RSRNEALR.KKKMEGDLNEMEIQL.QANRQAA.AQKQ.K.....LKD.Q.QLD.....NDDL.EN....ERRNNL.Q.ELEELRAALEQT
Retrocopy
SLQSSLDSETRSRNEALRVKKKMEGDLNEMEIQLNQANRQAADAQKQVKTLQGFLKDAQLQLDDTQHSNDDLRENITLLERRNNLIQSELEELRAALEQT


Parental protein
ERSRKLAEQDLLDVSERVQLLHSQNTGLINQKKKLESDTVQLQTEVEDAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQH
ERSRKLAEQ.L.D..ER.QLLHSQNT.LINQKKK.E.D...LQ.E.E...QE.RNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQH
Retrocopy
ERSRKLAEQELTDATERIQLLHSQNTSLINQKKKHEADLLNLQNEIEEIIQEHRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQH


Parental protein
RLDEAEQIAMKGGKKQVQKLEARVRDLENEVELEQKKSSDAVKGIRKYERRIKELTYQTEEDRKNTARLQDLVDKLQLKVKAYKRAAEEAEEQANTHLTK
RLDEAEQIAMKGGKKQVQKLEAR.R.LENE...EQK......KG.RKYERRIKELTYQTEEDRKN.ARLQDLVDKLQLKVK.YK.AA.EAEE.AN....K
Retrocopy
RLDEAEQIAMKGGKKQVQKLEARIRELENELDAEQKRGTESIKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKHAADEAEEAANANMAK


Parental protein
FRKLQHELDEAEERADIAESQVNKIRAKTRDVGSKSKL
.RKLQHEL.EAEERADIAE.QVNK.RAKTRD..SK...
Retrocopy
VRKLQHELEEAEERADIAEAQVNKLRAKTRDGSSKKNM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide