RetrogeneDB ID:
retro_olat_18
Organism:
Medaka ( Oryzias_latipes )
Location:
8:7212729-7215066 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.61 %
Coverage:
56.21 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
elfn1b
Parental gene aliases:
No gene alias available
Parental gene description:
extracellular leucine-rich repeat and fibronectin type III domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-080327-21]

Genomic region (view in browser)





>retro_olat_18
AGCTCAGGCATGGTGATGAGTGCCTTGTTTTGGTCTGTAACTATTGTATATCTGACTCAT
GTTGGGAGAGTGAATGGAGACTGCTGGTTAATCGAGGGAGAAAAGGGCTTTGTCTGGCTT
GCAATTTGTAGCCAAAACCAACCACCATTTGAGGCCATCCCACAGCATATCAACAGCACC
ATCGTAGACCTTCGTCTTAACGAAAACAAAATAAAAAGTATCCATTATTCTGCCCTTAGC
CGCTTTGCCAACTTAACCTACCTGAACTTGACCAAGAATGAAATTTCCTACATAGAGGAT
GGGGCCTTCTCTGCTCAGTTTAACCTACAAGTACTTCAAATGGGCTTCAACAAGCTACGG
AACCTGACAGAGGGGATTCTCCGGGGTCTGGGAAAGCTGCAGTACCTCTACCTCCAGGCA
AACCTGATTGAGACTGTGACACCTAATGCCTTTTGGGAGTGCCCAAACATCGAGAACATC
GATCTCTCCATGAATCGCATCCAGCAGTTGGATGGGTCCACCTTTACCAGTTTAACTAAA
CTAACCACCTGTGAGCTGTACACCAACCCTTTCAACTGCTCCTGTGAGTTACTGGGATTT
GTGAAATGGCTCTCAATTTTCCCAAACCGTACCAACGAGCGAATGGTGTGCGACTCCCCA
CCTGGCGTCTCAGGATACAGTTTACTGAGCCAGAATCCCAACAACCCAACGTACCGAAAT
GCCCTCCACATGCTGAAAACTGTGTGTACCGATGACTATGTGACACCATTCATCTCTATT
TCTATCGAGTCCACAACAATGCCACCCGACTCAACGCTTTGTGGGATGGATGAATGTCCG
TCAGGCACCGAACCAGAGGACATTACTGTTAGTACCACGGAAAACGAGGTGCAAGGAAAA
CTTAAGATGGAACTGAAGGAAATAACAAAAGCAGGGGCAACAATTACTATTCAGATTCCT
GATCCATACAAAAAGATGTACATCCTGGCTCTGTACAACAACAGCTTTTTCACAGATATT
CAAAACCTGAAAGACAAAAAGGAGGACATTGAGCTAAAAAACCTGAAACCACACATAAAC
TACACATACTGCATCGTTTCAATACGCAATTCTCTAAGACACAATCACACCTGCCTAATT
GTTTCTACAAACCCTCGGAATGGAAAAGAAAGAATTGTAAATCCTGCAACTGCTACTCAC
TACATTATGACAATTTTAGGTTGCCTCTTTAGTATGGTCATTTTTCTTGGGGTTGTTTAT
TACTGCCTGCGAAGAAAGCGCCAGCAAGAAGAAAAGCACAAAAAAGAAGGCAGCCTAAAG
AAAAATATAATGGAACTAAAGTATGGTCAAGAACTGGAAGGTGGGACTATTTCTCGAATG
TCGCAAAAGCAGTTATTGGCCGGGGAAAGCATGGGAAGAATGCCATACTTACCATCTACT
GGTGAAATGGAGCAGTATAAATTCCAGGAGATAAGTGAGACTCCGAAAATGATCAAGGGA
AACTACATGGATGTCAGAAGTATGGATCACCACGAGCGTAGAGAGTGTGATCTGGGAATG
GCCGGGAACAGTCAAGGATCAGTAGCTGAAATTTCAACAATTGCAAAAGAGGTAGATAAA
GTCAATCAGATCATTAACAACTGCATAGATGCCCTTAAGTCTGAATCCACTTCATTTCAG
GGGGTTAAATCTGGAGCTGTGTCTACCGCAGAACCTCAACTTGTCCTAATATCAGAGCAC
CCTCAGAATAAATCTGGTCTTTTATCCCCAGTTTATAAAGATAGCTACCACCACTCTCTG
CAGAGGCATCGAAGTTCCGATGTCTCTCCTAAGAGACCCAGCACTGCCACAGGAGGACCC
ATGAGAAGTCCAAGGCCTTATCGCTCTGAATCCAAGTACATAGAAAAAGCTTCCCCAACT
GGAGAGACCATCCTCACTGTAACACCAGCTGCTGCCATCCTCAGGGCTGAGGCAGAGAAG
ATCCGCCAGTACGGTGAGCACAGGCACTCATACCCCGATGCTCAGATAGAAGAACTGGAA
GGCCCCGACAGCCACAAGTTATTGGATCCTCTCACTCACTCCCGCTCCAGAGACTTAGCA
TTTTCCCAAATGCCGTCTCAGTATCACAATCTAAGCTACTCCTCCAGTCCTGAATACTAC
TGCAAACCCTCACACAGCATCTGGGAGCGCTTCAGACTCCACCGAAAACGCCATAAAGAT
GAGGAGTACATGGCTGCTGGCCATGCACTGCGAAAGAAAGTCCAGTTTGCAAAGGACGAG
GACCTGCATGACATTTTAGACTACTGGAAAGGAGTTTCAGCTCAAAATAAATCATAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ECWLIEGEKGFVWLAICSMNQPPYEAIPSHINSTIVDLRLNENKIRSIHYSSLSRFGNLTYLNLTKNDISYVEDGAFSALFNLQVLQMGFNKLRNLTEGM
.CWLIEGEKGFVWLAICS.NQPP.EAIP.HINSTIVDLRLNENKI.SIHYS.LSRF.NLTYLNLTKN.ISY.EDGAFSA.FNLQVLQMGFNKLRNLTEG.
Retrocopy
DCWLIEGEKGFVWLAICSQNQPPFEAIPQHINSTIVDLRLNENKIKSIHYSALSRFANLTYLNLTKNEISYIEDGAFSAQFNLQVLQMGFNKLRNLTEGI


Parental protein
LRGLGKLQYLYLQANVIETVTPNTFWECPNIENIDLSMNRIQMLDGSLFSGLSKLTTCELYTNPFNCSCELLAFLRWLAAFPNRTTERMVCDSPPGFSGY
LRGLGKLQYLYLQAN.IETVTPN.FWECPNIENIDLSMNRIQ.LDGS.F..L.KLTTCELYTNPFNCSCELL.F..WL..FPNRT.ERMVCDSPPG.SGY
Retrocopy
LRGLGKLQYLYLQANLIETVTPNAFWECPNIENIDLSMNRIQQLDGSTFTSLTKLTTCELYTNPFNCSCELLGFVKWLSIFPNRTNERMVCDSPPGVSGY


Parental protein
NLLSQNPRMPTQRNALHVLSLVCTDDGSSVTPF--YILDSTTMSPD---CGLDDCASGIPPEDVT-NPSPTSSDPKLRMRVKYVQHSSAVITVEIPHPYK
.LLSQNP..PT.RNALH.L..VCTDD...VTPF......STTM.PD...CG.D.C.SG..PED.T..........KL.M..K......A.IT..IP.PYK
Retrocopy
SLLSQNPNNPTYRNALHMLKTVCTDD--YVTPFISISIESTTMPPDSTLCGMDECPSGTEPEDITVSTTENEVQGKLKMELKEITKAGATITIQIPDPYK


Parental protein
KMYILMLYNNSFFTDIQNLKKQIEDVELKDLKPNTNYTYCVASIRNSLRFNHTCLIVSTGRREGAEHLPNQFSATHYIMTIVGCLFGMLLFLGLIVHGLR
KMYIL.LYNNSFFTDIQNLK...ED.ELK.LKP..NYTYC..SIRNSLR.NHTCLIVST..R.G.E...N...ATHYIMTI.GCLF.M..FLG.....LR
Retrocopy
KMYILALYNNSFFTDIQNLKDKKEDIELKNLKPHINYTYCIVSIRNSLRHNHTCLIVSTNPRNGKERIVNPATATHYIMTILGCLFSMVIFLGVVYYCLR


Parental protein
KRKKMEEKEKKMSRIQRTLKELKYGGEGDIEGGSGECVSQ-NLAGGDSMSRMPYLPQGAEIDPYKLQEVKETPGHKSAKLNYMDVRS
.....EEK.KK.........ELKYG.E...EGG.....SQ..L..G.SM.RMPYLP...E...YK.QE..ETP..K..K.NYMDVRS
Retrocopy
RKRQQEEKHKKEGSLKKNIMELKYGQE--LEGGTISRMSQKQLLAGESMGRMPYLPSTGEMEQYKFQEISETP--KMIKGNYMDVRS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide