RetrogeneDB ID:
retro_olat_22
Organism:
Medaka ( Oryzias_latipes )
Location:
13:5352225-5353148 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.47 %
Coverage:
92.99 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_olat_22
GGCTATAAAACCATCTCTAAGCAGCTGGAAGTTCCTGTGACAACAGTGGCACATATTATT
CAGAAGTTTAAGACCCACGGAACAGTAGCCAACCTCCCTGGACGTGGCCTGAAGAGGAAA
ATTGATGACAAATTGAGGAGACGGATGGTTAGAACTGTATCCAAAGAGCCCAGAACAACC
TCCAAAGACGTTAAAGGTGAACTCCTAGATCAAGGTACATCAGTGTCAGATTGCACCATT
TGTCGTTGTTCGAGCCAGAGTGGACTTCATGGGAGACGACCAAGGAGGACACCAATGTTC
AGGAAAGGAAATCATAAAAAAGACTGGAATTTGCAAAAATGCATGTTGACAAGCCACAAA
GCTTCTGGGAAAATGTCCTTTGGACAGATGAGACGAAACTGTAGCTTTTTGGTAAGGCAC
ATCAGCTCTATGTTTGTAGACTCAAAAATGAAGCACACAAGGAAAAGAACACTGTCCCAA
CTGTGAAACATGGAGGAGGCTCAGTTCTGTTTTGGGGCTGCTTTGCTGCATCTGGCACAG
GGAAATCTCAAGATTATCAAGGCATTCTGGATATAAATGTGCTGCCTAGTGTCAGAAAGC
TTGGTCTCAGTCGCAGGTCATGGGTCTTCCAACAGGACAACGATCCAAAACACACAGCCA
AAAACCGCCAAGAATGGCTAAGAGAAAAGCGTTGGACTATACTTAAGTGGCCTTCTATGA
GCCCAGATCTGAATCCCATTGAACATCTGTGGAAGGAGCTGAAACATGCCATTTGTAGAA
GACACCCATCAAACCTGAGACAACTGGAGCAGTTTGCTCATGAGGAGTGGGCCAAAATAC
CTGTGGACAGGTGCAGAAGGCTCATTGACAAATACAGAAACCGTTTAATTGCAGTGATTG
CCTCAAAAGGTTGTGCAACAAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GKEKINTHLSTXVTTVAHISQKFKTHGTVANLTGRW-KRNIDDKLRTRIVGTVSKEPRTTSKDIKSKLLDQSTSVSDRTIHGSFSQSGLHRRRPRRTPLL
G...I...L...VTTVAHI.QKFKTHGTVANL.GR..KR.IDDKLR.R.V.TVSKEPRTTSKD.K..LLDQ.TSVSD.TI....SQSGLH.RRPRRTP..
Retrocopy
GYKTISKQLEVPVTTVAHIIQKFKTHGTVANLPGRGLKRKIDDKLRRRMVRTVSKEPRTTSKDVKGELLDQGTSVSDCTICRCSSQSGLHGRRPRRTPMF


Parental protein
KGNHTKA-RLELAKMHVNKAQSFWENVLWTDETKLELFGEAHQLYVHRLKNEASNEKNTVPTVKHGGGSVLFWGCSAASATGCLEVVQDYQGIPGRNVLH
.....K..RLE.AKMHV.K.QSFWENVLWTDETKL.LFG.AHQLYV.RLKNEA..EKNTVPTVKHGGGSVLFWGC.AAS.TG......DYQGI...NVL.
Retrocopy
RKGNHKK/RLEFAKMHVDKPQSFWENVLWTDETKL*LFGKAHQLYVCRLKNEAHKEKNTVPTVKHGGGSVLFWGCFAASGTGKSQ---DYQGILDINVLP


Parental protein
SVRKLGLSWRSWVCQQANDPKHTAKTPEKRWTILKWPSMS-PHLNP----IEHQWKELKHAIWRRHPSNLRQLKQFVHEEWAKIPVDRCRRLIDKYRNRF
SVRKLGLS.RSWV.QQ.NDPKHTAK..........W.....P...P....IEH.WKELKHAI.RRHPSNLRQL.QF.HEEWAKIPVDRCRRLIDKYRNR.
Retrocopy
SVRKLGLSRRSWVFQQDNDPKHTAKNRQEWLREKRWTILKWPSMSPDLNPIEHLWKELKHAICRRHPSNLRQLEQFAHEEWAKIPVDRCRRLIDKYRNRL


Parental protein
IAVVTSKGCATK
IAV..SKGCAT.
Retrocopy
IAVIASKGCATR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide