RetrogeneDB ID:
retro_olat_24
Organism:
Medaka ( Oryzias_latipes )
Location:
13:31190005-31190444 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.95 %
Coverage:
53.48 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_olat_24
ATGGCCTCCACTCCTTCCGCCTTTCCCCCTTTCTCCTGCCCCATGTGCCATATGTTTAGT
GAGGATCCTGCCTCCTTTAGTGAAGACAGCGGTAGGTGTGTTAAGTGTAGTCTTGTGTTA
GACTTGAAGGCCAGGCTGGAGCAGTTAGAAGCGCGGCTCCGCACAGTGGAAGCTAAGCTG
GCTAGCTAGGTCGTTACTCGTAGCGTGCCGCACTGCCAGGGCTAACCCAGTTAGCACCCC
AGCACCTTCCCAGCAGCCGGGAAACACACAGGGTTTTGCACCGGTTGGGAGGAAACATAG
TGCTAAACGCAAGAACTTAGAGCATCCGAGACTCCACGTTAGTAATAGGTTCTCCCCCCT
CAGCGACACACCCGCTGAACACTCAACTCTGGTTATAGGCTCTTCTGAAGTTAGAAACGT
GGAGCTCCCAGCGGCTACA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MATTPSAFPPFSCSMCHMFSEDPASFSEDSGRCVKCSLVLDLETRLEQLEARRKFASLPATYVSTGRRGLRCRANP-VSTPAPSQQPGNTQGFAPVGRKH
MA.TPSAFPPFSC.MCHMFSEDPASFSEDSGRCVKCSLVLDL..RLEQLEAR..............R....C...P.VSTPAPSQQPGNTQGFAPVGRKH
Retrocopy
MASTPSAFPPFSCPMCHMFSEDPASFSEDSGRCVKCSLVLDLKARLEQLEARLRTVEAKLAS*VVTRSVPHCQG*P\VSTPAPSQQPGNTQGFAPVGRKH


Parental protein
SAKRKNLEHPRLHVNNRFSPLSDTPAEPSTLVIGSSEVRNVELPAAT
SAKRKNLEHPRLHV.NRFSPLSDTPAE.STLVIGSSEVRNVELPAAT
Retrocopy
SAKRKNLEHPRLHVSNRFSPLSDTPAEHSTLVIGSSEVRNVELPAAT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide