RetrogeneDB ID:
retro_olat_25
Organism:
Medaka ( Oryzias_latipes )
Location:
14:33082428-33082743 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
85.71 %
Coverage:
77.21 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PFDN4
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_olat_25
ACACACCGGACCAAGGAGCTAAAAAACGAAATTGAAGCAAACGAAAAAACTCTGCAGAAC
CTGCAGGAGGCCAGTGATGACATCACGATGCTGGATGACGACACCACGCTGATTTCATAT
CACATCGGTGGCGTGTTTGTCAGCCGCTCGCAGAAAGAAACGCAAAAGATGCTGGAGTCT
GCAAAGGAGGCGCTAGAGGAGGAGGTCAGAGGCTACGAGGAGAGAGTATCATCGATGCAG
CAGGTTCTGAACGGCCTGGAGGTCCAGATCTGTGCCAAATTTGGAGACAACATCAACCTG
GAGGCGGATGAGAGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TSRIKELKNEIEANKKTLQNLQDASDDIMMLDDDTMLIPYQIGGVFVSHSQEETQKMLESAKEALEEEVRGYEERVSSIQQVLNDLKVQLYAKFGDNINL
T.R.KELKNEIEAN.KTLQNLQ.ASDDI.MLDDDT.LI.Y.IGGVFVS.SQ.ETQKMLESAKEALEEEVRGYEERVSS.QQVLN.L.VQ..AKFGDNINL
Retrocopy
THRTKELKNEIEANEKTLQNLQEASDDITMLDDDTTLISYHIGGVFVSRSQKETQKMLESAKEALEEEVRGYEERVSSMQQVLNGLEVQICAKFGDNINL


Parental protein
EADES
EADES
Retrocopy
EADES


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide