RetrogeneDB ID:
retro_olat_26
Organism:
Medaka ( Oryzias_latipes )
Location:
15:20993523-20994516 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.0 %
Coverage:
98.51 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_olat_26
AAGCGAAGGAGAGAATTGTCCCAGGACATTAGAAACAAAATTATAGACAAACATCATAAA
GGTAAAGGCTGTAAAACCAACTCTAAGCAGCTTGAAGTTCCTGTGACAACAGTGGCACAT
ATTATTCAGAAGTTTAAGACCTATAGGACAGTAGCCAACCTCCCTGGACGTGGCCGGAAG
AGGAAAATTGATGACAAATTCAGGAGACAGATAGTTGGAACTGTTTCCAAAGAGCCCAGA
ACAACCTCCAAAGACATTAAAGGTGAACTCCCAGATCAAGGTACATCAGTGTCAGATCGC
ACCATTCGTCGTTGTTTGAGCCAGAGCGGACTTCATGGGAGACGACCAAGGAGGACACCA
CTGTTGAAAGGAAATCAATAAAAAGCCAGACTGGAATTTGCAAAAATGCATGTTGACAAG
CCACAAAGCTTCTGGGAAAATGTCCTTTGGACAGATGAGACAATACTGGAGCTTTTTGGT
AAGGCACATCAGCTTTATGTTGGTAACTCAAAAATGAAGCATCCAGCCAAAAGAACACTG
TCCCTACTGTGAAACATGGAGGAGGCTCAGTTCTGTGTTGGGGCTGCTTTGCTGCATCTG
GCACAGGGTGTCTTGAAGTTAAAGGTAAAATGCAATCTCAAGATTATCAAGGCATTCTGG
ATAGAAATGTGCTGCCTAGTGTCAGAAAGCTTGGTCTCAGTCGTGGGTCGTGGGTCTTCC
GACAGGACAAAACACACAGCCAAAAACACCAAATAACGGCTAAGAGAAAAGCGTTGGACT
ATTCTGAAGTGGCCTTCTATGAGTCTAGATCTGAATCCCATTGAACATCTGTGGAAGGAG
GTGAAATACGCCATTTGGAGAAGACACTGGTCAAACCTGAGACAACTGGAGCAGTTTGCT
CATGAGAAGTGGGCAAAAATACCTGTGGACAGGTGCAGAAGGCTCATTGACAAATACAGA
AACCGTTTCATTGCAGTGATTGCCTCAAAAGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKCKVMSEDLRGKTVKKE-QSQGYESISRDLNVPLFTVGNIIKRFAAHGSVDNLPGC-RLPSRADKLRRRIVGTVPKEPRTTSKDIKGELLDQGTSVSHR
K.....S.D.R.K...K.....G....S..L.VP..TV..II..F.....V.NLPG..R.....DK.RR.IVGTV.KEPRTTSKDIKGEL.DQGTSVS.R
Retrocopy
KRRRELSQDIRNKIIDKHHKGKGCKTNSKQLEVPVTTVAHIIQKFKTYRTVANLPGRGRKRKIDDKFRRQIVGTVSKEPRTTSKDIKGELPDQGTSVSDR


Parental protein
TIRGCLSQSGLHGRRPRR-PLLKGNPKKARLEFAKMHVDKPQSFWGNVLWTDETKLELFGKAHQLYVGR-LKNEASNQKNTVPTVKHGGGSVLFWGCFSA
TIR.CLSQSGLHGRRPRR.PLLKGN..KARLEFAKMHVDKPQSFW.NVLWTDET.LELFGKAHQLYVG..LKNEAS.QKNTVPTVKHGGGSVL.WGCF.A
Retrocopy
TIRRCLSQSGLHGRRPRRTPLLKGNQ*KARLEFAKMHVDKPQSFWENVLWTDETILELFGKAHQLYVGN/LKNEASSQKNTVPTVKHGGGSVLCWGCFAA


Parental protein
SDTGCLEVVQGQMKSQDDQGILDRNVLPSVRKLGLSLRSWIFQQDNDPKH-AKNPQEWLREKRWTILKWPSMSPDLNPIKHLWKELKHAIWRRHPSNLRH
S.TGCLEV..G.M.SQD.QGILDRNVLPSVRKLGLS..SW.F.Q..D..H.AKN....LREKRWTILKWPSMS.DLNPI.HLWKE.K.AIWRRH.SNLR.
Retrocopy
SGTGCLEV-KGKMQSQDYQGILDRNVLPSVRKLGLSRGSWVFRQ--DKTH\AKNTK*RLREKRWTILKWPSMSLDLNPIEHLWKEVKYAIWRRHWSNLRQ


Parental protein
LEQFAHEEWAKIPVDRCRRLIDKYRNRFIAVIASKG
LEQFAHE.WAKIPVDRCRRLIDKYRNRFIAVIASKG
Retrocopy
LEQFAHEKWAKIPVDRCRRLIDKYRNRFIAVIASKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide