RetrogeneDB ID:
retro_olat_36
Organism:
Medaka ( Oryzias_latipes )
Location:
24:20808776-20810134 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
86.9 %
Coverage:
50.23 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_olat_36
CAGCTTAGGGACGGACTGGAGAGGATTGATAAAAGCCACCTCCCAGGGAAATTCAAAGTG
TGGTGCTACCAATTCATCCTCTATCCACGCTTGATGTGGCCCCTGAAGATGATTACATCA
TCCACAGCAGCAAAGATGGATCCCAAAGCAAACAATTTCATCCGTAAGTGGCTTGGCTTA
CCTCGAAGTCTGTCCAACACAGGCCTTTTTGGGAGAAACACACTCCAGCTGCCACTGAAG
CCCATCAGCCTAGGCTACAGACAGGAGAAGACAAGGTTTGTGCTTAAGCTGAGAGACTCA
ACCGACCCAGTTGTAAGAAACACCAAGGCACCTGTCCGAACCGGAAGCAAATGGAAGGCA
GAAGAGGCTGTTGACCAGGCCATCAGCAAGCTTAAGCACAACGAAGTCGTGGGAAAGACG
CAGTCAGGCAGAGCTGGGTTAGGCTGGGGAACAGCCCCCAAGTTCTGGTCGAAAGCCAAA
AGAAGCAAGAGGAAAGAGCTGGTGATTGAAGAGGTGACCAGGAGCGTGGAAAACCAGTAC
AAGATCAAAGCACTCAGCCAGCCACAACAAGGGCGTAGGACAAATGGGAAGGCGTGGTCA
ATAGGACCATAGGGTGGTCTGATATATGGAAGATGCCTCAAGCAAGGCTGAGCTTCCTCA
TCCGGGCCACCTATGACACCCTACCCAGCCCCAGCAATCTGAGCCTATGGTTTGGCTCAG
AGGAAAACTGCCATCTCTGCAAGACTCCAAACCCTACGTTACAACACATCCTGTCCGGTT
GCAAAGCAGCTCTGGCCCAGGGTAGGCACAGATGGCGGCATGACCAGTCTTGAGGAAACT
GGCAGAGGTCCTGGAAGTACGGAGGATGGAGGCAGCTAAAGGACATCCCACGAAGACACC
GTCTTTGATTCACTTTGTTGGAGAAGGGGCTGGAGCACAGAACACCAACCAGAGAGGGAC
ACCATCACTGCTAACACCAGGATGCGACTGGAACTTAAGGGTGGACCTTGACCGTCAGCT
CAAGTTCCCACCAGAAATAACTACCACCTCTCTGCGACCAGACATCATCCTGTGGTCCTC
TGCAGCCAAAGCAGCAATCCTGACAGAGCTCACAATCCCTTCGGAGGGAGGAATGGATGC
TGCATATGAAAGGGAGGAAGGAAAAATACACAGAGCTGGTAGCTGAGTGCCGAGATGCTG
GGTGGTCAACCATCATCTGCCCGGTGGAGGTTGGCTGCAGGGGCTTTGTTGGAACATCCA
CCCAGCTCCTCCTTAGGAAGATGGGAGTGACTGGGTCGAAATTGAAGAAGGCATCCGAGG
ACTTGGCGGATGAGGCGGAAAAAGCCAGTTTCTGGCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QLKDGLERIDKSHLPGKFKVWCYQFILNPRLMWPLKLCEITSSTVAKMDAKANNFIRKWLGLPQSLSNTGLFGR----LPLKPISLGYRQEKTRLVLELR
QL.DGLERIDKSHLPGKFKVWCYQFIL.PRLMWPLK...ITSST.AKMD.KANNFIRKWLGLP.SLSNTGLFGR....LPLKPISLGYRQEKTR.VL.LR
Retrocopy
QLRDGLERIDKSHLPGKFKVWCYQFILYPRLMWPLKM--ITSSTAAKMDPKANNFIRKWLGLPRSLSNTGLFGRNTLQLPLKPISLGYRQEKTRFVLKLR


Parental protein
DSTNPVIRNTKAPVRTGSKWKAEEAVDQAISKLKHNKIVGKTQSGRAGLGWRIAPKFWSKATRSEKKELVIEEVTRSEENQYKIKALSQPQQGRWTT-WD
DST.PV.RNTKAPVRTGSKWKAEEAVDQAISKLKHN..VGKTQSGRAGLGW..APKFWSKA.RS..KELVIEEVTRS.ENQYKIKALSQPQQGR.T..W.
Retrocopy
DSTDPVVRNTKAPVRTGSKWKAEEAVDQAISKLKHNEVVGKTQSGRAGLGWGTAPKFWSKAKRSKRKELVIEEVTRSVENQYKIKALSQPQQGRRTN/WE


Parental protein
---QRTIVWSDIWKMPQARLSFLIRATYDTLPSPSNLSLWFGSEENCHLCKTPSPTLQHILSGCKAALAQGRYRWRHDQ-VLRKLAEVLEVRRMEAAKDP
....RTI.WSDIWKMPQARLSFLIRATYDTLPSPSNLSLWFGSEENCHLCKTP.PTLQHILSGCKAALAQGR.RWRHDQ.VLRKLAEVLEVRRMEAAK..
Retrocopy
GVVNRTIGWSDIWKMPQARLSFLIRATYDTLPSPSNLSLWFGSEENCHLCKTPNPTLQHILSGCKAALAQGRHRWRHDQ/VLRKLAEVLEVRRMEAAKGH


Parental protein
PTKTPSLIHFVGEGAGAQNTNQRGTPSLLTPGCDWNLRVDLDRQLNVCESIITWHL---IILWSSAAKAVILAELTIPWEGGMDAAYEK-KKDKYTELVA
PTKTPSLIHFVGEGAGAQNTNQRGTPSLLTPGCDWNLRVDLDRQL.....I.T..L...IILWSSAAKA.IL.ELTIP.EGGMDAAYE...K.KYTELVA
Retrocopy
PTKTPSLIHFVGEGAGAQNTNQRGTPSLLTPGCDWNLRVDLDRQLKFPPEITTTSLRPDIILWSSAAKAAILTELTIPSEGGMDAAYER\RKEKYTELVA


Parental protein
ECRDAGWSTIICPVEVGCRGFVGTCTQLLLSKMGVTGSKLKKASKDLAEEAEKASFWL
ECRDAGWSTIICPVEVGCRGFVGT.TQLLL.KMGVTGSKLKKAS.DLA.EAEKASFWL
Retrocopy
ECRDAGWSTIICPVEVGCRGFVGTSTQLLLRKMGVTGSKLKKASEDLADEAEKASFWL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide