RetrogeneDB ID:
retro_olat_37
Organism:
Medaka ( Oryzias_latipes )
Location:
24:17287534-17287844 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.58 %
Coverage:
57.54 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
STMN2 (1 of 2)
Parental gene aliases:
No gene alias available
Parental gene description:
stathmin-like 2 [Source:HGNC Symbol;Acc:10577]

Genomic region (view in browser)





>retro_olat_37
CCCAAAAAGAAGGACATCTCCCTGGAGGAGATTCAGAGAAAGCTGGATGCCGCAGAGGGA
AGACGCAAGAACCATGAAGCCGAGGTTCTGAAGCACCTAGCTGAGAAGCGAGAGCACGAA
AAGGAGGTGCCACAGAAAGCAATGGAGAAGAACAACAACTTCAGCAAGATGGCAGAGGAG
AAGCTCAACCAAAAGATGGAGGCCAACAAGAAGAACCGCAGCTGCCATCATGGCAGCCAT
TAACGAGAAGTTCATGGAGAAGGACAAGAAGTTGGAAGAGGTGCGAAAGAACAAGGAGAC
CAAAGATCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PPKRDISLEDIEKKLEAAEERRKYQEAQVLRALAEKREHERDVLLKAMEENSNFSKMAEEKLHMKMEQIKENREAH-MAAMMERLLEKEKRAVVVRRNKE
P.K.DISLE.I..KL.AAE.RRK..EA.VL..LAEKREHE..V..KAME.N.NFSKMAEEKL..KME..K.NR..H.MAA..E...EK.K....VR.NKE
Retrocopy
PKKKDISLEEIQRKLDAAEGRRKNHEAEVLKHLAEKREHEKEVPQKAMEKNNNFSKMAEEKLNQKMEANKKNRSCH\MAAINEKFMEKDKKLEEVRKNKE


Parental protein
LREE
....
Retrocopy
TKDQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide