RetrogeneDB ID:
retro_olat_43
Organism:
Medaka ( Oryzias_latipes )
Location:
8:4642586-4643435 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.54 %
Coverage:
85.67 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_olat_43
AAGTGAAGGAGAGAATTGTCCCAGGACATTATAAACAAAATTATAGACAAACATAGTAAA
GGTAAAGGCTATAAAACCATCTCTAAGCAGCTTGAAGTTTCTGTGACGACAGTGGCATAT
ATGATTCAGAAGTTTAAGACCCACGGGACAGTAGCCAACCTCCCTGGACGTGGCAGGAAG
AGGAAAATTGAGGAGACGGATAGTTGGAACTGTATCCAAAGAGACAAGAACAACCTCCAA
AGACGTTAAAGGTGACCTCCTAGATCAAGGTACATCAGTGTCAGATCGCACCATTCATCA
CTGTTTGAGCCAGAGTGGACTTCATGGGAGACGACCAAGGAGGACACCACTGTTGACAGG
AAATCATAAAAAAGCCAGACTGGAATTTACCAAAATGCATGTTGACAAGCCCCAAAGCTT
CTGGGAAAATGTCCTTTGGACAGATGAGACCAAACTGGAGCTTTTTGGTAAGGCACATCA
GCTCTATTTTTGTAGACTCAAAAATGAAGCATACAACCAAAAGAACACTGTCCCTACTGT
GAAACATGGAGGAGGCTCAGTTCTGTTTTGGGGCTGCTTTGCTGCATCTGGCACAGGGTG
TCTTGAAGTTGTGCAAAGGAAAATGAAATCTCCAGATTATCAAGGCATTCTGGATAGAAA
TGTGCTGCCAAGTGTCAGAAAGCTTAGTCTCAGTTGCAGGTCATGGGTCTTCAAACAGGA
CACCGATCCAAAACACACAGCCAAAACCCCCCAAAAATGGCTCAGAGAAAAGCGTTGGAA
TATTCTGAAGTGGCCTCTATGAGCCCAGATCTGAATCCCATTGAACATCTGTGGAAGGAG
CTGAAACAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KPRRELSQDIRNKIIDKHRKGKGYKTISKQLEVPVTTVAHTIQKFKTHRTVVNLPGRRE-RAELRTRKKELVMSVEKYAFSEHQREYTHQGTSVSNHTIR
K.RRELSQDI.NKIIDKH.KGKGYKTISKQLEV.VTTVA..IQKFKTH.TV.NLPGR...R..LR.R....V.................QGTSVS..TI.
Retrocopy
K*RRELSQDIINKIIDKHSKGKGYKTISKQLEVSVTTVAYMIQKFKTHGTVANLPGRGR\RGKLRRRIVGTVSKETRTTSKDVKGDLLDQGTSVSDRTIH


Parental protein
GCLSQSGLHGRRPRRTPLLKGNHK-TRLEFAKMHVDKPQSFWENVLWTDETKLELFGKAHQLYVRRLKNEAYNEKSTVPTVKHGGGSVLFWGCFAASGTE
.CLSQSGLHGRRPRRTPLL.GNHK..RLEF.KMHVDKPQSFWENVLWTDETKLELFGKAHQLY..RLKNEAYN.K.TVPTVKHGGGSVLFWGCFAASGT.
Retrocopy
HCLSQSGLHGRRPRRTPLLTGNHKKARLEFTKMHVDKPQSFWENVLWTDETKLELFGKAHQLYFCRLKNEAYNQKNTVPTVKHGGGSVLFWGCFAASGTG


Parental protein
CLEVVQGQMKSPDYQGILGRNVLPSVRKLGLSRRSWVFQQDNDPKH-AKNPQEWLREKHWTILKWP-SMSPDLNPIEHLWKKRRH
CLEVVQ..MKSPDYQGIL.RNVLPSVRKL.LS.RSWVF.QD.DPKH.AK.PQ.WLREK.W.ILKWP.SMSPDLNPIEHLWK...H
Retrocopy
CLEVVQRKMKSPDYQGILDRNVLPSVRKLSLSCRSWVFKQDTDPKHTAKTPQKWLREKRWNILKWP/SMSPDLNPIEHLWKELKH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide