RetrogeneDB ID:
retro_olat_57
Organism:
Medaka ( Oryzias_latipes )
Location:
scaffold6628:2527-2964 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
50.34 %
Coverage:
63.25 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
ighv6-2
Parental gene aliases:
No gene alias available
Parental gene description:
immunoglobulin heavy variable 6-2 [Source:ZFIN;Acc:ZDB-GENE-040514-24]

Genomic region (view in browser)





>retro_olat_57
AGCATTACAGAATCTGAAGCAGCAGTTAAAACACCTGGAGAGTCCCACAGACTCACCTGT
ACAACATCTGGATTTGACTTTAGAGGCTCAGTGTGGAACTGGATCAGACAGACTCCTGGG
AAAGGACTGGAGTGGATCTCTTTGGTGCACACATCCAGCAGCCCAATCTATTACTCAGAG
TCAGTGAAGAACAGATTTACCATCTTCAGAGATGACTCCAGCAGTAAAGTCTATCTGCAG
ATGAGCAATCTGAAGGCAGAAGACACAGCAATGTATTACTGTGCAGAAGAGACATACTGA
CTGAAGTGTTTGAAGAGTCACGCACAAACTATTTCCTCTGTTTACAACTGAAACAGGAGC
TGGAGAGTGTCTGTGTTAGTTTAAAAACACAAACTACAAATGATTGTCAGGAATGGGAGG
TGAAGGACTCAAAGAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TLTESESVVKRPGESHRLTCSASGFTFSSYGMNWVRQAPGKGLEWIAYICTSSSPIYYSQSVQGRFSISRDDSSSKLYLQMNSLRMEDTAVYYCA-RRDT
..TESE..VK.PGESHRLTC..SGF.F.....NW.RQ.PGKGLEWI....TSSSPIYYS.SV..RF.I.RDDSSSK.YLQM..L..EDTA.YYCA.RRD.
Retrocopy
SITESEAAVKTPGESHRLTCTTSGFDFRGSVWNWIRQTPGKGLEWISLVHTSSSPIYYSESVKNRFTIFRDDSSSKVYLQMSNLKAEDTAMYYCA/RRDI


Parental protein
VRDILGTDVQKKDQMSCCQPSRSSNQSSSSSSSSSCVKCEQLTQPDSVS
................C.Q..........S........C......DS.S
Retrocopy
LTEVF--EESRTNYFLCLQLKQELESVCVSLKTQTTNDCQEWEVKDSKS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide