RetrogeneDB ID:
retro_olat_8
Organism:
Medaka ( Oryzias_latipes )
Location:
11:26656745-26657066 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.0 %
Coverage:
96.08 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
inip (2 of 2)
Parental gene aliases:
No gene alias available
Parental gene description:
ints3 and nabp interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-961]

Genomic region (view in browser)





>retro_olat_8
ATGGCTACTCCTGCTAACCCGCCAGTTCCGGGCTTCCAGAACAAAACCCGGGTGGCCATC
CTCGCGGAGCTGGACAAGGAGAAGAGGCGCCTGCTGCAGAGCCAGTCCATGAACAGCCCC
GGGGCCACCATCCCGCTGGCCTCGTCCAGGCCCAGCCTGAAGGAGGCGCGGGACAGCGCG
GAGCAGCAGCACATCGCCGCGCAGCAGAAGGCCGCGCTGCAGCACGCGCACGGACACTCG
TCGGGCTTCTTCATCACGCAGGACTCCTCGTTCGGGAACCTGATCCTGCCGGTGCTGCCC
CGGCTGGAGCCCGAGCTCTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ANPPGQAVPNNARVAILAELERERRRLIQSQSMNTPGASISL--SRPSVKDFRDNAEQQHIAAQQKAALQHAHAHSSGFFITQDSSFGNLILPVIPRLVP
ANPP.....N..RVAILAEL..E.RRL.QSQSMN.PGA.I.L..SRPS.K..RD.AEQQHIAAQQKAALQHAH.HSSGFFITQDSSFGNLILPV.PRL.P
Retrocopy
ANPPVPGFQNKTRVAILAELDKEKRRLLQSQSMNSPGATIPLASSRPSLKEARDSAEQQHIAAQQKAALQHAHGHSSGFFITQDSSFGNLILPVLPRLEP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide