RetrogeneDB ID:
retro_olat_9
Organism:
Medaka ( Oryzias_latipes )
Location:
19:4483597-4484740 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.79 %
Coverage:
97.46 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
adrb2b
Parental gene aliases:
No gene alias available
Parental gene description:
adrenergic receptor, beta 2b [Source:ZFIN;Acc:ZDB-GENE-070410-32]

Genomic region (view in browser)





>retro_olat_9
ATGGGGGACGGCGGCGCGTCCTCTCCAGTGACCCCCCACAACGGCACTGGAACCGAGGCG
TCCAACGGGCAGGGCACCGTTCCAGCCGCGTCCGAGCAGTGGACAGCAGGCATGAGTCTG
GTGATGGCTTTGATTGTGCTGTCCATTGTTTTTGGGAATATCCTGGTGATCTTGGCCATA
GCCAGGACGCAGAGGCTGCAGACCCTCACCAATGTGTTCATCGTATCGCTGGCCAGTGCA
GATCTCATCATGGGCTTACTTGTTGTGCCGTTTGGCGCTGTGCTCGAGGTGCGCGGCTTG
TGGCTTTACGGCTCTTTTTTCTGTGAGATCTGGACCTCTGTGGATGTCCTCTGCGTCACC
GCCAGCATAGAGACCCTGTGCGTAATCGCCATAGACAGGTACGTGGCCATCACTTCACCT
TTCCGCTACCAAAGCTTGTTAACCAAAAGTCGGGCCAAAGCGGTGGTGTGTGTGGTGTGG
GCCATCTCTGCGCTGGTCTCCTTCCTCCCCATCCTGATGCACTGGTCCCGCGACAGCATG
GACACGGACTGCTACGAAAACCCCCAATGCTGCGACTTTGTCACCAACAGGGCATATGCC
ATCTCCTCCTCCGTTATCTCCTTCTACATTCCTCTCGTGGTGATGATTTTTGTTTACGCA
CGCGTGTACAGAGAAGCGAAAAAGCAGCTCAAAAAGATCGACAAGTGTGAGGGCAGGTTT
CACAACACCCTGACAGGGCTGACCTCCAAGTGCAAGAAGAGACCTTCAAAGATCTTGGCG
CTCAGGGAGCAAAAGGCGCTGAAAACTCTGGGAATCATCATGGGGACGTTCACTCTGTGC
TGGCTGCCCTTCTTCATAGTCAACGTTGTGCGCGTATTTTGCGCAGAGCTTGTGGACAAG
AACGTCTTCGTGTTCCTGAACTGGCTGGGTTACGTGAACTCTGCCTTTAACCCAATTATT
TACTGCCGGAGTCCGGACTTCAGGAAGGCTTTTAAGAGGCTGCTGTGCTGCCCGAGGCAA
GCCGATCGCAGGCTGCACATCAGCTCCTGCGACCTGACGCGCTGCTCCGGCGGGTTCGTG
TCAGCGCTGGAGCCTGGCACGCTGGAGATGTGGTCCGACTGCGCCGTGTTGGACAGCAGC
GAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LAVAMAILVLAIVFGNVMVISAILRFHRLQTVTNLFIASLAVADLIMGVVVVPFSSSNILLRSWKFGNFMCEFWTAADVLCVTASIETLCVIALDRYLAI
....MA..VL.IVFGN..VI.AI.R..RLQT.TN.FI.SLA.ADLIMG..VVPF.........W..G.F.CE.WT..DVLCVTASIETLCVIA.DRY.AI
Retrocopy
MSLVMALIVLSIVFGNILVILAIARTQRLQTLTNVFIVSLASADLIMGLLVVPFGAVLEVRGLWLYGSFFCEIWTSVDVLCVTASIETLCVIAIDRYVAI


Parental protein
TLPLRYPTLLTRARAFAAILAVWAVASLISFLPIYLKLWLSDEQKAQDCMKKEDCCEFHTNKGYAVISSIVSFYLPLVVMIFLYSRVFQEAQKQLKKIRD
T.P.RY..LLT..RA.A....VWA...L.SFLPI....W..D.....DC.....CC.F.TN..YA.ISS.V.......V.......V........KK...
Retrocopy
TSPFRYQSLLTKSRAKAVVCVVWAISALVSFLPILMH-WSRDSMDT-DCYENPQCCDFVTNRAYA-ISSSVISFYIPLVVMIF---VYARVYREAKK-QL


Parental protein
GESDKGEKNEENRANTQKEEGKHTAAKRLKFSLKEHKALKTLGIIMGTFTLCWLPFFILNIVMAYYKGDSINVPFRLLNWLGYSNSAFNPLIYCRSPDFR
...DK.E....N.........K....K.L...L.E.KALKTLGIIMGTFTLCWLPFFI.N.V............F..LNWLGY.NSAFNP.IYCRSPDFR
Retrocopy
KKIDKCEGRFHNTLTGLTSKCKKRPSKIL--ALREQKALKTLGIIMGTFTLCWLPFFIVNVVRVFCAELVDKNVFVFLNWLGYVNSAFNPIIYCRSPDFR


Parental protein
HAFQEIL
.AF...L
Retrocopy
KAFKRLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide