RetrogeneDB ID:
retro_opri_1
Organism:
Location:
scaffold_47677:238-853 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.1 %
Coverage:
96.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ARHGDIB
Parental gene aliases:
No gene alias available
Parental gene description:
Rho GDP dissociation inhibitor (GDI) beta [Source:HGNC Symbol;Acc:679]

Genomic region (view in browser)





>retro_opri_1
ATGGCCGAGCAGGAGTCCACGGCCGAGCAGCTGGCGCAGATCGCCGCCGAGAACGAGGAG
GACGAGCACTCGGTCAACTACAAGCCGCCGGCGCAGAAGAGCATCCAGGAGATCCAGGAG
CTGGACAAGGACGACGAGAGCCTGCGCAAGTACAAGGAGGCGCTGCTGGGCCGCGTGGCC
GTGTCGGCCGACCCCAGCGTGCCCAACGTGGTGGTGACGCGCCTCACGCTCTTGTGCAGC
TCGGCGCCCGGGCCCCTGGAGCTGGACCTGACGGGTGACCTGGAGAGCTTCAAGAAGCAG
TCCTTTGTGCTGAAGGAGGGCGTGGAGTACCGGATAAAGATCTCCTTCCGGGTGAACCAC
GAGATCGTGTCAGGCATGAAGTACATCCAGCACACCTACCGGAAGGGCGTCAAGATCGAC
AAGACCGACTACATGGTGGGGAACTATGGGCCCCGCGCCGAGGAGTATGAGTTCCTGACG
CCCATGGAGGAGGCACCCAAGGGCATGCTGGCACGCGGCAGTTACAGCATCAAGTCCCGC
TTCACCGATGATGACAAGACGGACCACCTGTCCTGGGAGTGGAACCTCACCATCAAGAAG
GAGTGGAAGGACTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QVVEDDDELDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDGPVVADPTAPNVTVTRLTLVCESAPGPITMDLTGDLEALKKKVFVLKEGAEYRV
Q......E.....NYKPP.QKS..E.QE.DKDDESL.KYK..LLG...V.ADP..PNV.VTRLTL.C.SAPGP...DLTGDLE..KK..FVLKEG.EYR.
Retrocopy
QIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPSVPNVVVTRLTLLCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRI


Parental protein
KINFKXXXXXXXGLKYVQHTYRTGMKVDKVTFMVGSYGPRPEEYEFLTPIEEAPKGMLARGTYHTKSFFTDDDKQDHLTWEWNLSIKKDWTE
KI.F........G.KY.QHTYR.G.K.DK...MVG.YGPR.EEYEFLTP.EEAPKGMLARG.Y..KS.FTDDDK.DHL.WEWNL.IKK.W..
Retrocopy
KISFRVNHEIVSGMKYIQHTYRKGVKIDKTDYMVGNYGPRAEEYEFLTPMEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKEWKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide