RetrogeneDB ID:
retro_opri_10
Organism:
Location:
scaffold_9763:43835-45719 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.2 %
Coverage:
98.07 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TKT
Parental gene aliases:
No gene alias available
Parental gene description:
transketolase [Source:HGNC Symbol;Acc:11834]

Genomic region (view in browser)





>retro_opri_10
GCGATGGCCACTGCCTGCGACGCAGTGCCCAACCCGGCGACCGTGCAGGGGCTGCGGGAT
GTGGCCAACCGCCTGCGCGTCCTCGCCATCAGGGCCACGTGTGCCTGCAGCTCGGGCCAC
CCCACGTCCTGCTGCAGTGCCGCGGAGATCATGGCCGTCCTCTTCTTCCACACAATGCGG
TACAAACAGACGGAGCCCGAGCACCCCGACAACGACCGATTCGTCCTCTCCAAGGGCCAC
GCCGCCCCGGTCCTCTACGCCGCCTGGATGGAGGCTGGCCATGTCAGCGAGGCAGACCTG
CTGAACCTGAGGAAAGTGCACTGCGACCTGGAGGGGCATCCCACCCCTCGGCTGTCGTTC
GTGGACGTGGCCACGGGCTCCCTGGGGCAAGGGCTGGGCGCTGCGTGCGGAATGGCCTAC
ACCGGCAAGTACTTGGACAAGGCCAGCTACCGCGTGTTCTGCCTCATGGGGGACGGGGAG
TCCTCCGAGGGCTCGGTCTGGGAGGCCCTGGCGTTCGCCTCCCACTACCGTCTGGACAAT
CTCGTGGCGGTCTTCGACGTGAACCGCTTGGGGCAAAGCGGCAGCACACCCTTGGGGCAC
TGCACCGACGTGTACCAGGAGCGCTGTGAAGCCTTTGGGTGGAATACCTGCTTGGTGGAC
GGCCACGATGTGGAGGCCTTGTGTCGGGCATTTTGGCAAGCAACCCAGGTACAGAACAAG
CCCACGGCTATCATCGCCAAGACCTTCAAGGGTCGAGGCATCCCGAACATTGAAGACGCA
GAAAACTGGCACGGAAAGCCAGTGCCAAGAGAGAGAGCGGATGCCATTGTCAAGTTGATC
GAGAGTCAGATCCAGACCCACAGCAGTCTCATACCCAAAGCCCCCGTGGAAGACTCCCCT
CCGGTCAACATCACGAATATAAAGATGACCTCCCCACCTGCTTACAAAGTCGGCCACGTG
ATGGCCACTCGAAAAGCATGTGGCTTGGCTCTAGCCAAACTGGGTCACGCCCACGAAAGG
GTGATCGTCCTGGACGGTGACACGAAGAACTCCACCTTCTCCGAGATCTTCAAGAAAGAG
CACCCGGAGCGTTTCATCGAATGCTTTATCGCGGAGCAGAACATGGTGAGCGTGGCCCTG
GGGTGCGCCGCACGTGGTCGGACCGTAGCCTTTGCCAGCACCTTCGCTGCCTTTTTAACT
CGAGCTTTCGATCAGCTCCGAATGGGAGCCATCTCTGAAAGCAACATCAACCTCGTTGGT
TCCCACTGCGGCGTGTCCGTAGGTGAGGACGGCCCTTCCCAGATGGCCCTGGAGGATCTG
GCCATGTTCCGAAGCATTCCCGGCTGCACTGTTTTCTACCCGAGCGACGCGGTCTCCACG
GAGCACGCTGTGCGTCTCGCCGCCAACACCAAAGGTATGTGCTTCATCCGCACCAGCAGA
CCAGAAACTGCAGTTCTCTATACTCCGCAAGAAAATTTTGCGGTTGGACAGGCCAAGGTA
TTGCGCCACAGCGTTGAGGACGAGGCCACGGTCATCGGAGCTGGGGTCACTCTGCACGAA
GCCTTAGCTGCCGCCGGGGATCTTTCTCAAGAAGGTATTTCCATTCGGGTCATTGACCTG
TTCACCGTGAAGCCCCTGGACGCAGGCACCATCGTCTCCAACGCGAGAGCCACGGGAGGT
CGGCTGCTCACCGTGGAGGACCACTACCCAGAAGGCGGCATCGGAGAAGCGGTGTGCGCA
GCCGTCGCCCAGCAGCCGGGCATCCGTGTCCGGCAGCTGGCAGTGTCCCACGTGCCCCGG
AGTGGGAAACCCAGCGAACTGCTGGACATGTTCGGGATTAGTGCCAGACACATTGCCGAG
GCTGTAAAGTGCATGTTGAAGTAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKAQDPRNPHNDRFVLSKGHAAPILYAVWAEAGYLPEAELLNLRKISSD
P.....Q.L.D.ANRLR...I.AT.A..SGHPTSCCSAAEIMAVLFFHTMRYK...P..P.NDRFVLSKGHAAP.LYA.W.EAG...EA.LLNLRK...D
Retrocopy
PNPATVQGLRDVANRLRVLAIRATCACSSGHPTSCCSAAEIMAVLFFHTMRYKQTEPEHPDNDRFVLSKGHAAPVLYAAWMEAGHVSEADLLNLRKVHCD


Parental protein
LDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASFYKLDNLVAILDVNRLGQSDPTPLQHQVDVYQKRC
L.GHP.P...F.DVATGSLGQGLGAACGMAYTGKY.DKASYRV.CL.GDGE.SEGSVWEA.AFAS.Y.LDNLVA..DVNRLGQS..TPL.H..DVYQ.RC
Retrocopy
LEGHPTPRLSFVDVATGSLGQGLGAACGMAYTGKYLDKASYRVFCLMGDGESSEGSVWEALAFASHYRLDNLVAVFDVNRLGQSGSTPLGHCTDVYQERC


Parental protein
EAFGWHAIIVDGHSVEELCKAFGQA---KHQPTAIIAKTFKGRGITGIEDKESWHGKPLPKNMADQVIQEIHNQIQSKKKILATPPQEDAPSVDISNIRM
EAFGW....VDGH.VE.LC.AF.QA......PTAIIAKTFKGRGI..IED.E.WHGKP.P...AD.....I..QIQ.........P.ED.P.V.I.NI.M
Retrocopy
EAFGWNTCLVDGHDVEALCRAFWQATQVQNKPTAIIAKTFKGRGIPNIEDAENWHGKPVPRERADAIVKLIESQIQTHSSLIPKAPVEDSPPVNITNIKM


Parental protein
PSPPNYKVGDKIATRKAYGQALAKLGHGSDRIIALDGDTKNSTFSELFKKEHPDRFIECYIAEQNMVSVAVGCATRNRTVPFCSTFAAFLTRSFDQIRMA
.SPP.YKVG...ATRKA.G.ALAKLGH...R.I.LDGDTKNSTFSE.FKKEHP.RFIEC.IAEQNMVSVA.GCA.R.RTV.F.STFAAFLTR.FDQ.RM.
Retrocopy
TSPPAYKVGHVMATRKACGLALAKLGHAHERVIVLDGDTKNSTFSEIFKKEHPERFIECFIAEQNMVSVALGCAARGRTVAFASTFAAFLTRAFDQLRMG


Parental protein
AISESNINLCGSHCGVSIGEDGPSQMALEDLAMFRSLPMSTVFYPSDAVATEKAVELAANTKGICFIRTSRPENTIIYNNNEDFQIGQAKVVQKNKDDQV
AISESNINL.GSHCGVS.GEDGPSQMALEDLAMFRS.P..TVFYPSDAV.TE.AV.LAANTKG.CFIRTSRPE....Y...E.F..GQAKV......D..
Retrocopy
AISESNINLVGSHCGVSVGEDGPSQMALEDLAMFRSIPGCTVFYPSDAVSTEHAVRLAANTKGMCFIRTSRPETAVLYTPQENFAVGQAKVLRHSVEDEA


Parental protein
TVIGAGVTLHEALAAAELLKKERINIRIVDPFTIKPLDKKLILESARATKGRILTVEDHYYEGGIGEAVSTAVVGEPGITVTRLAVAQVPRSGKPAELLK
TVIGAGVTLHEALAAA..L..E.I.IR..D.FT.KPLD...I...ARAT.GR.LTVEDHY.EGGIGEAV..AV...PGI.V..LAV..VPRSGKP.ELL.
Retrocopy
TVIGAGVTLHEALAAAGDLSQEGISIRVIDLFTVKPLDAGTIVSNARATGGRLLTVEDHYPEGGIGEAVCAAVAQQPGIRVRQLAVSHVPRSGKPSELLD


Parental protein
MFGIDKDAIAQAVR
MFGI....IA.AV.
Retrocopy
MFGISARHIAEAVK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide