RetrogeneDB ID:
retro_opri_1073
Organism:
Location:
scaffold_6601:45510-46266 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.63 %
Coverage:
52.58 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MKRN1
Parental gene aliases:
No gene alias available
Parental gene description:
makorin ring finger protein 1 [Source:HGNC Symbol;Acc:7112]

Genomic region (view in browser)





>retro_opri_1073
GCTGTCGGAGGAGCAGGTGTAGAAGGCTGGGAAGATGCTGTGGAGTTTGTTCCCGGGCAG
CCCTATCGGGGCCGCGGGGTGGCTTCCATTCCTGAAGCGCCTCCCCAGGGCTCAGAGGTG
GTCGAGAGGGAGCAGGTGGCTGTGGGCAGGGGGGTGCAACTTTGCCCTCACGCTGCCAGG
GGAGAATGCTTCCGTGGGGAGAGCTGTATGTATCTGCACGGAGAGGTATGCGACATGTGT
GGGCTCCAGGCCTTGCACCCCATGGATGCCGCGCAGAGGGCAGACCATAGGCAGGCCTGC
ATGGAGGCACATGAGAAAGATATGGAGCTGTCATTTGCAGTGCAACGCAGCATGGATAAG
GTGTGCGGCATCTGCATGGAGGTGGTGTACGACAAGGCCAACCCCAGCGACCGCCGCTTT
GGCATCCTGTCCAACTGCAGCCATCCCTACTGCCTCAAGTGTATCCGTAGGTGGCGACGC
GCCAGACACTTTGAGAATAGGATCGTCAAGTCCTGCCCGCAGTGCAGGGTCACCTCCAAC
TTCGTCATTCCCAGTGAGTTCTGGGTGGAGGAAGAGGAAGAGAAGGAGAAACTCATTCAG
CAGTACAAGGAGGCTCTGAGCAACAAGCCCTGTCGGCATTTTGCGGAAGGCAGAGGCCAC
TGCCCCTTTGGAGAGCACTGCTTTTATAAGCACTCGTCCCCTGAGCGCCAGGGAGAGGAG
CCTCCCGGGCAGGGCGGGGGCCCATCCCTCACCTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ATVGAGSEDWVNAIEFVPGQPYCGRTASSCTEAPPQGSVTQEESEKEQTAAETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPTDAAQRSQHI
A..GAG.E.W..A.EFVPGQPY.GR...S..EAPPQGS...E..E.EQ.A.....QLCP.AA.GEC..GE.C.YLHG..CDMCGLQ.LHP.DAAQR..H.
Retrocopy
AVGGAGVEGWEDAVEFVPGQPYRGRGVASIPEAPPQGS---EVVEREQVAVGRGVQLCPHAARGECFRGESCMYLHGEVCDMCGLQALHPMDAAQRADHR


Parental protein
KSCIEAHEKDMELSFAVQRSKDLLCGICMEVVYEKANPSERRFGILSNCSHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQK
..C.EAHEKDMELSFAVQRS.D..CGICMEVVY.KANPS.RRFGILSNCSH.YCLKCIR.WR.A..FE..I.KSCP.CR.TSNFVIPSE.WVEE.EEK.K
Retrocopy
QACMEAHEKDMELSFAVQRSMDKVCGICMEVVYDKANPSDRRFGILSNCSHPYCLKCIRRWRRARHFENRIVKSCPQCRVTSNFVIPSEFWVEEEEEKEK


Parental protein
LIQKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRY
LIQ.YKEA.SNK.CR.F.EGRG.CPFG..CFYKH..P....EEP..Q..G.S..Y
Retrocopy
LIQQYKEALSNKPCRHFAEGRGHCPFGEHCFYKHSSPERQGEEPPGQGGGPSLTY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide