RetrogeneDB ID:
retro_opri_1075
Organism:
Location:
scaffold_66442:4907-5408 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.67 %
Coverage:
61.4 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HNRNPDL
Parental gene aliases:
No gene alias available
Parental gene description:
heterogeneous nuclear ribonucleoprotein D-like [Source:HGNC Symbol;Acc:5037]

Genomic region (view in browser)





>retro_opri_1075
AAGCTGTTCGTAGGAGGACTCCACTACGGTGTTAGTAAGGAAACCCTCCTTAACTATATG
TCTCAGTTTGGTGAGATCTTGGACATTTTGATTAAACTCGATCCAGATACTGGGTTATCC
AGGGGATTTGGATTCGTACTTTTCAAAGATAGTGACAGTGCCGAAAAGGTGCTCCAAGTA
AAAGAGCACACACTTGATGGGAAGAAAATAGATATTAAAAGGGCAAGAGCAATGGAATCT
AAATATCCCCCTAAGAAGGTCTTTGTAGGTGGCCTCAATCCCCGTATATCTGAAGCAAAG
ATCAGAGAGTACTTTGGGAGTTACGGAGAGATTGAGAACATTGAGCTTCCTGTGTGCCCC
AAAACACAACAAAGAAGAGCTTTCTGTTTCATCACTTACGCTAGTGAGGTATCAGTGAGA
AAGCTGTTAGAAAGCAGGTACCATCTAATTGGCTCTGGACGATGTGAAATTAAAATTGCC
ACCTCAAAAGAAAATCTGAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQ
K.F.GGL....SK..L..Y.S.FGE..D..IK.DP.TG.SRGFGFVLFKD..S..KVL..KEH.LDGK.ID.KRA.A...K.PPKKVFVGGL.P..SE..
Retrocopy
KLFVGGLHYGVSKETLLNYMSQFGEILDILIKLDPDTGLSRGFGFVLFKDSDSAEKVLQVKEHTLDGKKIDIKRARAMESKYPPKKVFVGGLNPRISEAK


Parental protein
IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYR
I.EYFG..GEIENIELP...KT..RR.FCFITY..E..V.KLLESRYH.IGSG.CEIK.A..KE..R
Retrocopy
IREYFGSYGEIENIELPVCPKTQQRRAFCFITYASEVSVRKLLESRYHLIGSGRCEIKIATSKENLR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide