RetrogeneDB ID:
retro_opri_1174
Organism:
Location:
scaffold_8752:46309-47155 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.46 %
Coverage:
74.87 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
GABPA
Parental gene aliases:
No gene alias available
Parental gene description:
GA binding protein transcription factor, alpha subunit 60kDa [Source:HGNC Symbol;Acc:4071]

Genomic region (view in browser)





>retro_opri_1174
CTGGATCCAGAGCGAAGTATATTTGACCAAGGAGTAAAGACAGATGGAACTGTACAGCTT
AGTGTACAGGTAATTTCTTACCGAGGAATTGAGCCGAAGCTGAACATCCTTGAAATTGTT
AAAACTGCAGAAACTGTTGAAGTGGTCATTGATCCCGACGCCCACCATGCTGAAGCTGAG
GCACATCTTCTTGAGGAAGCTCAGGTGATAACCCTGGACGGCACCAAGCATATCACCACC
ATTTCAGATGAAACCTCAGAGCAGGTGACGAGATGGGCTGCCGCGCTGGAAGGTTACAGG
AAGGAACAAGAACGCCTCGGGATACCCTATGATCCTATACAGTGGTCCACAGACCAAGTC
CTACATTGGGTGGTTTGGGTCATGAAGGAATTCAGCATGACTGACATAGATCTCACCACA
CTCAACATTTCCAGAAGAGAATTATGTAGTCTCAGCCAAGAAGATTTTTTTCAACGAGTC
CCTCGGGGAGAGATTCTTTGGAGTCATCTGGAGCTTCTTCGAAAATATGTGTTGGCAAGC
CAAGAGCAACAGATGAATGAGATAGTCACCATCGATCAACCTGTGCAAATTATTCCCGCT
TCAGTGCAGTCAGCCACACCCACTGCCATTAAAGTCCTGAACAGCAGTGCCAAAGCAGCC
AAAGTCCAGAGGGCTCCACGGATTTCAGAAGACAGGAGATCACCTGGGAACAGAACAGGA
AAAAATGGACAGATCCAGCTATGGCAGTTTTTACTAGAACTCCTTACTGACAAAGATGCT
CGAGACTGTATTTCATGGGTTGGTGATGAAGGTGAATTTAAACTAAATCAACCTGAGCTG
GCAGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKTAETVEVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYR
LDPERS.FDQGVKTDGTVQLSVQVISY.GIEPKLNILEIVKTAETVEVVIDPDAHHAEAEAHL.EEAQVITLDGTKHITTISDETSEQVTRWAAALEGYR
Retrocopy
LDPERSIFDQGVKTDGTVQLSVQVISYRGIEPKLNILEIVKTAETVEVVIDPDAHHAEAEAHLLEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYR


Parental protein
KEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLSQEDFFQRVPRGEILWSHLELLRKXXXXXXXXXXXXXXXXXXXVQIIPA
KEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNIS.RELCSLSQEDFFQRVPRGEILWSHLELLRK...................VQIIPA
Retrocopy
KEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISRRELCSLSQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPA


Parental protein
SVQSATPTAIKVLNSSAKAAKVQRAPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVA
SVQSATPTAIKVLNSSAKAAKVQRAPRIS.EDR.SPGNRTG.NGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPEL.A
Retrocopy
SVQSATPTAIKVLNSSAKAAKVQRAPRIS-EDRRSPGNRTGKNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELAA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide