RetrogeneDB ID:
retro_opri_1186
Organism:
Location:
scaffold_9059:5763-6195 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.75 %
Coverage:
94.74 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
UBE2B
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2B [Source:HGNC Symbol;Acc:12473]

Genomic region (view in browser)





>retro_opri_1186
CTCATGTGGGATTTCAAGCGATTGCAAGAGGACCCTCCTGTGGGTGTCAGTGGCGCACCC
TCTGAGAACAACATCATGCAGTGGAATGCGATTATATTTGACCCAGAAGGGACACCCTTT
GAAGATGGTACTTTTAAACTAGTAATAGAATTTTCTGAAGAATATCCAAATAAGCCACCA
ACTGTTAGGTTTTTATCCAAAATGTTTCATCCAAATGTGTGTGATGACGGTAGCATATGT
TTAGATATCCTTCAGAATCGATGGAGTCCAACATATGACGTATCTTCTATCTTAACATCC
ATTCAGTCTCTGCTGGATGAACCAAATCCAAACAATTCAGCCAATAGCCAGGCAGCACAG
CTTTATCAGGAAAACAAACGGGAATACGAGAAGAGAGTTTGGATCATTGTGGAGCAAAGC
TGGAATGACTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTS
LM.DFKRLQEDPPVGVSGAPSENNIMQWNA.IF.PEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNV..DGSICLDILQNRWSPTYDVSSILTS
Retrocopy
LMWDFKRLQEDPPVGVSGAPSENNIMQWNAIIFDPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVCDDGSICLDILQNRWSPTYDVSSILTS


Parental protein
IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
IQSLLDEPNPN..ANSQAAQLYQENKREYEKRV..IVEQSWNDS
Retrocopy
IQSLLDEPNPNNSANSQAAQLYQENKREYEKRVWIIVEQSWNDS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide