RetrogeneDB ID:
retro_opri_1188
Organism:
Location:
scaffold_9112:14303-14504 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.15 %
Coverage:
72.83 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL37A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L37a [Source:HGNC Symbol;Acc:10348]

Genomic region (view in browser)





>retro_opri_1188
ATGGTGAGGCAGATTGAAAGCTGTGAGCATGCCAAGTACACCTGCTCAGTCTGTGACAAA
ACCAAGATGAAGAGGTGTGCCATGTGCATCTGGTGCTGTGGTTCCTGCATACAGAAAACG
TCTGGTGGGGCCTGGATGTGCAACACCACTTCCGCCGTCACAGTCAAGTCTGCAGCCAGA
AGACTGCAAGAATTGAAAGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD
MV..IE...HAKYTCS.C.KTKMKR.A..IW.CGSC.....GGAW..NTTSAVTVKSA.RRL.ELKD
Retrocopy
MVRQIESCEHAKYTCSVCDKTKMKRCAMCIWCCGSCIQKTSGGAWMCNTTSAVTVKSAARRLQELKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide