RetrogeneDB ID:
retro_opri_1226
Organism:
Location:
scaffold_9966:47339-47739 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.73 %
Coverage:
99.26 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
RSL24D1
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal L24 domain containing 1 [Source:HGNC Symbol;Acc:18479]

Genomic region (view in browser)





>retro_opri_1226
GTGTTTAGATTCTGTAAATCCAAATGTCATAAAAACTTTAAAAAGAAGCGTAATCCTCGC
AAGGTCAGGTGGGCCAAAGCATTCCGGAAAGCAGCCGGCAAGGAACTGACAGTGGATAAT
TCATTTGATTTGAAAAACGAAGAAATGAACCTATCAAATACCAGAGAGAGTGTGGATAAA
ACTATTGATGCAATGAAGAGAGTTGAAGAGATGTAGCAGAAAAGCCAAGCTAAATTTATA
ATGAACAGATTGAAGAAAAATAAAGAACTACAGAAAGATTAGGACATCAAAGAAGTCAAG
CAGAATATTCACCTCATCCGGGCTCCTGTTGCAGGCAAACAGCTGGAAAGAAAAAAATGG
TACAGCAGGTACAAGAAAGATGTGGACATGGGAGGATACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFE-FEKRRNEPVKYQRE-LW-NKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDI
VFRFCKSKCHKNFKKKRNPRKVRW.KAFRKAAGKELTVDNSF..FEKRRNEP.KYQRE..W..KTIDAMKRVEE..QK.QAKFIMNRLKKNKELQK..DI
Retrocopy
VFRFCKSKCHKNFKKKRNPRKVRWAKAFRKAAGKELTVDNSFD/FEKRRNEPIKYQRE/VW/DKTIDAMKRVEEM*QKSQAKFIMNRLKKNKELQKD*DI


Parental protein
KEVKQNIHLIRAPVAKGKQLE-DKMVQQLQEDVDM-EDT
KEVKQNIHLIRAPVA.GKQLE..K.......DVDM.EDT
Retrocopy
KEVKQNIHLIRAPVA-GKQLERKKWYSRYKKDVDM\EDT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide