RetrogeneDB ID:
retro_opri_125
Organism:
Location:
GeneScaffold_2535:43204-43450 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.44 %
Coverage:
78.85 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
DBI
Parental gene aliases:
No gene alias available
Parental gene description:
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690]

Genomic region (view in browser)





>retro_opri_125
AGCCAGGTGGAATTTGAGATGGCGTGCGCGGCCGTCAAGCAGCTCAAGAACCCTCTGAGC
GACCAGGAGAAGCTGCTGCTGTACAGCCTCTACAAACAGGCCACTCAGGGCGACTGCAAC
CTCCCTGTGCCTCCTGTCTCAGAGGTGAGAGCCAAGGCCAAGTGGGAGGCGTGGAACAAG
ATCAAAGGCATGTCCAAGATGGACGCCATGAGGAACTATGTGGCCAAAGTGGATGAGCTG
AAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TEAEFEKAAEEVKNLKAKPSDPEMLFIYSHYKQATVGDVNTDRPGMLDLKGKAKWDAWNELKGTSKESAMKAYVDKVEELKQ
...EFE.A...VK.LK...SD.E.L..YS.YKQAT.GD.N...P.......KAKW.AWN..KG.SK..AM..YV.KV.ELK.
Retrocopy
SQVEFEMACAAVKQLKNPLSDQEKLLLYSLYKQATQGDCNLPVPPVSEVRAKAKWEAWNKIKGMSKMDAMRNYVAKVDELKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide