RetrogeneDB ID:
retro_opri_187
Organism:
Location:
GeneScaffold_3416:53965-54259 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.49 %
Coverage:
51.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FTL
Parental gene aliases:
No gene alias available
Parental gene description:
ferritin, light polypeptide [Source:HGNC Symbol;Acc:3999]

Genomic region (view in browser)





>retro_opri_187
CTCTTGAAGAGGCAAAATCAGCACACTAGTCACACCCTCTTTCAGGATGTACAGAAGCCA
ATCCAAGATGAGTGGGGCAAAACCCAAGATGCCCTGGAAGCCTCCTTGGGCCTGGAGAAG
AAACTGAACCAGGCCCTTCTGGAACTTCACACCTTGGCTTCTGCTGGCATAGACTCTCAT
TTCTGTAACTTCTTGGAGAACCACTTCCTGGACGAGGAGGTAAAATTTCTCAAGAAGACA
GATAACCACCTAACCCACATCTGCAGAGTGACCAGTCCCCAGGGCCGCCAGGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLKMQNQRGGRALFQDVQKPPQDEWGKTQDALEAALGLEKNLNQALLELHALGSAHTDPHLCDFLENHFLDEEVKLLKKMGDHLTNIRRVAAPQGAQA
LLK.QNQ.....LFQDVQKP.QDEWGKTQDALEA.LGLEK.LNQALLELH.L.SA..D.H.C.FLENHFLDEEVK.LKK...HLT.I.RV..PQG.QA
Retrocopy
LLKRQNQHTSHTLFQDVQKPIQDEWGKTQDALEASLGLEKKLNQALLELHTLASAGIDSHFCNFLENHFLDEEVKFLKKTDNHLTHICRVTSPQGRQA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide